Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone deacetylase 9

Gene

HDAC9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Represses MEF2-dependent transcription.
Isoform 3 lacks active site residues and therefore is catalytically inactive. Represses MEF2-dependent transcription by recruiting HDAC1 and/or HDAC3. Seems to inhibit skeletal myogenesis and to be involved in heart development. Protects neurons from apoptosis, both by inhibiting JUN phosphorylation by MAPK10 and by repressing JUN transcription via HDAC1 recruitment to JUN promoter.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone. EC:3.5.1.98

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by Trichostatin A (TSA) and suberoylanilide hydroxamic acid.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi646ZincBy similarity1
Metal bindingi648ZincBy similarity1
Metal bindingi654ZincBy similarity1
Metal bindingi731ZincBy similarity1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei783By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, Hydrolase, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.5.1.98 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-2644606 Constitutive Signaling by NOTCH1 PEST Domain Mutants
R-HSA-2894862 Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UKV0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Histone deacetylase 9 (EC:3.5.1.98)
Short name:
HD9
Alternative name(s):
Histone deacetylase 7B
Short name:
HD7
Short name:
HD7b
Histone deacetylase-related protein
MEF2-interacting transcription repressor MITR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HDAC9
Synonyms:HDAC7, HDAC7B, HDRP, KIAA0744, MITR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000048052.21

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14065 HDAC9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606543 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UKV0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving HDAC9 is found in a family with Peters anomaly. Translocation t(1;7)(q41;p21) with TGFB2 resulting in lack of HDAC9 protein.1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
9734

Open Targets

More...
OpenTargetsi
ENSG00000048052

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38377

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4145

Drug and drug target database

More...
DrugBanki
DB05015 Belinostat
DB06603 Panobinostat
DB00313 Valproic Acid

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2620

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HDAC9

Domain mapping of disease mutations (DMDM)

More...
DMDMi
19865267

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001147101 – 1011Histone deacetylase 9Add BLAST1011

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei22PhosphoserineCombined sources1
Modified residuei220PhosphoserineBy similarity1
Modified residuei240PhosphoserineBy similarity1
Modified residuei451PhosphoserineBy similarity1
Modified residuei554PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Ser-220 and Ser-450; which promotes 14-3-3-binding, impairs interaction with MEF2, and antagonizes antimyogenic activity. Phosphorylated on Ser-240; which impairs nuclear accumulation (By similarity). Isoform 7 is phosphorylated on Tyr-1010. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import.By similarity1 Publication
Sumoylated.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UKV0

PeptideAtlas

More...
PeptideAtlasi
Q9UKV0

PRoteomics IDEntifications database

More...
PRIDEi
Q9UKV0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84881
84882 [Q9UKV0-2]
84883 [Q9UKV0-3]
84884 [Q9UKV0-4]
84885 [Q9UKV0-5]
84886 [Q9UKV0-6]
84887 [Q9UKV0-7]
84888 [Q9UKV0-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UKV0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UKV0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Broadly expressed, with highest levels in brain, heart, muscle and testis. Isoform 3 is present in human bladder carcinoma cells (at protein level).4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000048052 Expressed in 217 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_HDAC7
HS_HDAC9

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UKV0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UKV0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028926

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with CTBP1. The phosphorylated form interacts with 14-3-3 (By similarity). Interacts with HDAC1 and HDAC3, and probably with HDAC4 and HDAC5. Interacts with MEF2, MAPK10, ETV6, NCOR1 and BCL6. Interacts with FOXP3 in the absence of T-cell stimulation.By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115083, 59 interactors

Database of interacting proteins

More...
DIPi
DIP-39904N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9UKV0

Protein interaction database and analysis system

More...
IntActi
Q9UKV0, 29 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000408617

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9UKV0

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UKV0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UKV0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni23 – 27Interaction with CTBP1By similarity5
Regioni136 – 154Interaction with MEF2By similarityAdd BLAST19
Regioni175 – 343Interaction with MAPK10By similarityAdd BLAST169
Regioni218 – 261Interaction with ETV61 PublicationAdd BLAST44
Regioni631 – 978Histone deacetylaseAdd BLAST348

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1343 Eukaryota
COG0123 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160307

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232065

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057100

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UKV0

KEGG Orthology (KO)

More...
KOi
K11409

Identification of Orthologs from Complete Genome Data

More...
OMAi
GAHKLPR

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0EQO

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UKV0

TreeFam database of animal gene trees

More...
TreeFami
TF106174

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.800.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000286 His_deacetylse
IPR023801 His_deacetylse_dom
IPR037138 His_deacetylse_dom_sf
IPR024643 Hist_deacetylase_Gln_rich_N
IPR017320 Histone_deAcase_II_euk
IPR023696 Ureohydrolase_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10625 PTHR10625, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12203 HDAC4_Gln, 1 hit
PF00850 Hist_deacetyl, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037911 HDAC_II_euk, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01270 HDASUPER

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52768 SSF52768, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (11+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 11 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 11 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UKV0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHSMISSVDV KSEVPVGLEP ISPLDLRTDL RMMMPVVDPV VREKQLQQEL
60 70 80 90 100
LLIQQQQQIQ KQLLIAEFQK QHENLTRQHQ AQLQEHIKEL LAIKQQQELL
110 120 130 140 150
EKEQKLEQQR QEQEVERHRR EQQLPPLRGK DRGRERAVAS TEVKQKLQEF
160 170 180 190 200
LLSKSATKDT PTNGKNHSVS RHPKLWYTAA HHTSLDQSSP PLSGTSPSYK
210 220 230 240 250
YTLPGAQDAK DDFPLRKTAS EPNLKVRSRL KQKVAERRSS PLLRRKDGNV
260 270 280 290 300
VTSFKKRMFE VTESSVSSSS PGSGPSSPNN GPTGSVTENE TSVLPPTPHA
310 320 330 340 350
EQMVSQQRIL IHEDSMNLLS LYTSPSLPNI TLGLPAVPSQ LNASNSLKEK
360 370 380 390 400
QKCETQTLRQ GVPLPGQYGG SIPASSSHPH VTLEGKPPNS SHQALLQHLL
410 420 430 440 450
LKEQMRQQKL LVAGGVPLHP QSPLATKERI SPGIRGTHKL PRHRPLNRTQ
460 470 480 490 500
SAPLPQSTLA QLVIQQQHQQ FLEKQKQYQQ QIHMNKLLSK SIEQLKQPGS
510 520 530 540 550
HLEEAEEELQ GDQAMQEDRA PSSGNSTRSD SSACVDDTLG QVGAVKVKEE
560 570 580 590 600
PVDSDEDAQI QEMESGEQAA FMQQPFLEPT HTRALSVRQA PLAAVGMDGL
610 620 630 640 650
EKHRLVSRTH SSPAASVLPH PAMDRPLQPG SATGIAYDPL MLKHQCVCGN
660 670 680 690 700
STTHPEHAGR IQSIWSRLQE TGLLNKCERI QGRKASLEEI QLVHSEHHSL
710 720 730 740 750
LYGTNPLDGQ KLDPRILLGD DSQKFFSSLP CGGLGVDSDT IWNELHSSGA
760 770 780 790 800
ARMAVGCVIE LASKVASGEL KNGFAVVRPP GHHAEESTAM GFCFFNSVAI
810 820 830 840 850
TAKYLRDQLN ISKILIVDLD VHHGNGTQQA FYADPSILYI SLHRYDEGNF
860 870 880 890 900
FPGSGAPNEV GTGLGEGYNI NIAWTGGLDP PMGDVEYLEA FRTIVKPVAK
910 920 930 940 950
EFDPDMVLVS AGFDALEGHT PPLGGYKVTA KCFGHLTKQL MTLADGRVVL
960 970 980 990 1000
ALEGGHDLTA ICDASEACVN ALLGNELEPL AEDILHQSPN MNAVISLQKI
1010
IEIQSMSLKF S
Length:1,011
Mass (Da):111,297
Last modified:October 18, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i43ED2785E73CD924
GO
Isoform 2 (identifier: Q9UKV0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     487-574: Missing.

Show »
Length:923
Mass (Da):101,805
Checksum:i095F634F623A684F
GO
Isoform 3 (identifier: Q9UKV0-3) [UniParc]FASTAAdd to basket
Also known as: HDRP, MITR

The sequence of this isoform differs from the canonical sequence as follows:
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Note: Major form in most tissues. Inactive due to lack of active site residues.
Show »
Length:590
Mass (Da):65,887
Checksum:i02931057CF0E4C25
GO
Isoform 4 (identifier: Q9UKV0-4) [UniParc]FASTAAdd to basket
Also known as: HDAC9a

The sequence of this isoform differs from the canonical sequence as follows:
     861-879: GTGLGEGYNINIAWTGGLD → RFISLEPHFYLYLSGNCIA
     880-1011: Missing.

Show »
Length:879
Mass (Da):97,471
Checksum:iD3BFC3CE99E817DB
GO
Isoform 5 (identifier: Q9UKV0-5) [UniParc]FASTAAdd to basket
Also known as: HDAC9b, HDAC9fl

The sequence of this isoform differs from the canonical sequence as follows:
     1006-1011: MSLKFS → KYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQPFAQEDSRTAGEPMEEEPAL

Show »
Length:1,066
Mass (Da):117,208
Checksum:iEE7D908DF45D20CB
GO
Isoform 6 (identifier: Q9UKV0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: K → KLQQ
     218-261: Missing.
     1006-1011: MSLKFS → KYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQPFAQEDSRTAGEPMEEEPAL

Note: Excluded from the nucleus. Does not interact with ETV6.Curated
Show »
Length:1,025
Mass (Da):112,451
Checksum:i3BEFD662BF24E677
GO
Isoform 7 (identifier: Q9UKV0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: K → KLQQ
     1006-1011: MSLKFS → KYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQPFAQEDSRTAGEPMEEEPAL

Show »
Length:1,069
Mass (Da):117,577
Checksum:i5DFBB8DD4C6547C5
GO
Isoform 8 (identifier: Q9UKV0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMSSPAQPDLMWNLVPWVLFCGCCRIFPDGVAGREQLLAQQRM
     218-261: Missing.
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Note: No experimental confirmation available.
Show »
Length:588
Mass (Da):65,508
Checksum:iE58854328ED1B5BE
GO
Isoform 9 (identifier: Q9UKV0-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-261: Missing.
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Show »
Length:546
Mass (Da):60,761
Checksum:iCFC8BA27CFD1AA31
GO
Isoform 10 (identifier: Q9UKV0-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.
     88-88: K → KLQQ
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Show »
Length:562
Mass (Da):62,852
Checksum:i6557FECB5FFF1A5A
GO
Isoform 11 (identifier: Q9UKV0-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.
     177-178: Missing.
     218-261: Missing.
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Show »
Length:513
Mass (Da):57,092
Checksum:i3868A8C73426BCC2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z3P7B7Z3P7_HUMAN
cDNA, FLJ79008, highly similar to H...
HDAC9
549Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JD56C9JD56_HUMAN
Histone deacetylase 9
HDAC9
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZS0C9IZS0_HUMAN
Histone deacetylase 9
HDAC9
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MCF1B5MCF1_HUMAN
Histone deacetylase 9
HDAC9
577Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J1W4C9J1W4_HUMAN
Histone deacetylase 9
HDAC9
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J835C9J835_HUMAN
Histone deacetylase 9
HDAC9
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDS2F8WDS2_HUMAN
Histone deacetylase 9
HDAC9
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLX1C9JLX1_HUMAN
Histone deacetylase 9
HDAC9
22Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Isoform 6 : The sequence AAI11736 differs from that shown. Reason: Frameshift at position 1021.Curated
The sequence BAA34464 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti16V → A in BAH12570 (PubMed:14702039).Curated1
Sequence conflicti99L → I in AAF04254 (PubMed:10523670).Curated1
Sequence conflicti153S → I in BAH14164 (PubMed:14702039).Curated1
Sequence conflicti315S → F in BAH14176 (PubMed:14702039).Curated1
Sequence conflicti332L → M in BAH14164 (PubMed:14702039).Curated1
Sequence conflicti416V → F in BAH14164 (PubMed:14702039).Curated1
Sequence conflicti437T → P in AAF04254 (PubMed:10523670).Curated1
Sequence conflicti644 – 647HQCV → KPNS in AAF04254 (PubMed:10523670).Curated4
Sequence conflicti746H → R in AAO27363 (PubMed:12590135).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_064719921P → T Found in a renal cell carcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1333490692Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0468271 – 31Missing in isoform 10 and isoform 11. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0434281M → MMSSPAQPDLMWNLVPWVLF CGCCRIFPDGVAGREQLLAQ QRM in isoform 8. 1 Publication1
Alternative sequenceiVSP_02376688K → KLQQ in isoform 6, isoform 7 and isoform 10. 3 Publications1
Alternative sequenceiVSP_046828177 – 178Missing in isoform 11. 1 Publication2
Alternative sequenceiVSP_023767218 – 261Missing in isoform 6, isoform 8, isoform 9 and isoform 11. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_002082487 – 574Missing in isoform 2. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_002083575 – 590PFLEP…SVRQA → VIGKDLAPGFVIKVII in isoform 3, isoform 8, isoform 9, isoform 10 and isoform 11. 3 PublicationsAdd BLAST16
Alternative sequenceiVSP_002084591 – 1011Missing in isoform 3, isoform 8, isoform 9, isoform 10 and isoform 11. 3 PublicationsAdd BLAST421
Alternative sequenceiVSP_002085861 – 879GTGLG…TGGLD → RFISLEPHFYLYLSGNCIA in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_002086880 – 1011Missing in isoform 4. 1 PublicationAdd BLAST132
Alternative sequenceiVSP_0237681006 – 1011MSLKFS → KYWKSVRMVAVPRGCALAGA QLQEETETVSALASLTVDVE QPFAQEDSRTAGEPMEEEPA L in isoform 5, isoform 6 and isoform 7. 3 Publications6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY032737 mRNA Translation: AAK66821.1
AY032738 mRNA Translation: AAK66822.1
AJ459808 mRNA Translation: CAD30851.1
AY197371 mRNA Translation: AAO27363.1
AB018287 mRNA Translation: BAA34464.2 Different initiation.
AK297404 mRNA Translation: BAH12570.1
AK304298 mRNA Translation: BAH14153.1
AK304343 mRNA Translation: BAH14164.1
AK304410 mRNA Translation: BAH14176.1
AC002088 Genomic DNA No translation available.
AC002124 Genomic DNA No translation available.
AC002410 Genomic DNA No translation available.
AC002433 Genomic DNA No translation available.
AC004744 Genomic DNA No translation available.
AC004994 Genomic DNA No translation available.
AC005249 Genomic DNA No translation available.
AC010082 Genomic DNA No translation available.
AC074193 Genomic DNA No translation available.
AC091697 Genomic DNA No translation available.
CH471073 Genomic DNA Translation: EAW93702.1
CH471073 Genomic DNA Translation: EAW93703.1
BC111735 mRNA Translation: AAI11736.1 Frameshift.
BC150328 mRNA Translation: AAI50329.1
BC152405 mRNA Translation: AAI52406.1
AF124924 mRNA Translation: AAF04254.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47553.1 [Q9UKV0-7]
CCDS47554.1 [Q9UKV0-5]
CCDS47555.1 [Q9UKV0-1]
CCDS47557.1 [Q9UKV0-3]
CCDS56465.1 [Q9UKV0-8]
CCDS56466.1 [Q9UKV0-9]
CCDS56467.1 [Q9UKV0-10]
CCDS56468.1 [Q9UKV0-11]
CCDS83163.1 [Q9UKV0-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001191073.1, NM_001204144.2 [Q9UKV0-8]
NP_001191074.1, NM_001204145.2 [Q9UKV0-9]
NP_001191075.1, NM_001204146.2
NP_001191076.1, NM_001204147.2 [Q9UKV0-11]
NP_001191077.1, NM_001204148.2 [Q9UKV0-10]
NP_001308797.1, NM_001321868.1
NP_001308798.1, NM_001321869.1
NP_001308799.1, NM_001321870.1
NP_001308800.1, NM_001321871.1
NP_001308801.1, NM_001321872.1
NP_001308802.1, NM_001321873.1
NP_001308803.1, NM_001321874.1
NP_001308804.1, NM_001321875.1
NP_001308805.1, NM_001321876.1
NP_001308806.1, NM_001321877.1 [Q9UKV0-6]
NP_001308807.1, NM_001321878.1
NP_001308808.1, NM_001321879.1
NP_001308813.1, NM_001321884.1
NP_001308814.1, NM_001321885.1
NP_001308815.1, NM_001321886.1
NP_001308816.1, NM_001321887.1
NP_001308817.1, NM_001321888.1
NP_001308818.1, NM_001321889.1
NP_001308819.1, NM_001321890.1
NP_001308820.1, NM_001321891.1 [Q9UKV0-9]
NP_001308822.1, NM_001321893.1 [Q9UKV0-9]
NP_001308823.1, NM_001321894.1
NP_001308824.1, NM_001321895.1
NP_001308825.1, NM_001321896.1 [Q9UKV0-10]
NP_001308826.1, NM_001321897.1 [Q9UKV0-6]
NP_001308827.1, NM_001321898.1
NP_001308828.1, NM_001321899.1
NP_001308829.1, NM_001321900.1 [Q9UKV0-3]
NP_001308830.1, NM_001321901.1
NP_001308831.1, NM_001321902.1
NP_055522.1, NM_014707.3 [Q9UKV0-3]
NP_478056.1, NM_058176.2 [Q9UKV0-1]
NP_848510.1, NM_178423.2 [Q9UKV0-5]
NP_848512.1, NM_178425.3 [Q9UKV0-7]
XP_011513940.1, XM_011515638.2
XP_011513941.1, XM_011515639.2
XP_016868315.1, XM_017012826.1
XP_016868317.1, XM_017012828.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.196054
Hs.444785

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000401921; ENSP00000383912; ENSG00000048052 [Q9UKV0-6]
ENST00000405010; ENSP00000384382; ENSG00000048052 [Q9UKV0-3]
ENST00000406451; ENSP00000384657; ENSG00000048052 [Q9UKV0-5]
ENST00000417496; ENSP00000401669; ENSG00000048052 [Q9UKV0-8]
ENST00000428307; ENSP00000395655; ENSG00000048052 [Q9UKV0-9]
ENST00000432645; ENSP00000410337; ENSG00000048052 [Q9UKV0-1]
ENST00000441542; ENSP00000408617; ENSG00000048052 [Q9UKV0-7]
ENST00000456174; ENSP00000388568; ENSG00000048052 [Q9UKV0-10]
ENST00000524023; ENSP00000430036; ENSG00000048052 [Q9UKV0-11]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9734

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9734

UCSC genome browser

More...
UCSCi
uc003sud.2 human [Q9UKV0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY032737 mRNA Translation: AAK66821.1
AY032738 mRNA Translation: AAK66822.1
AJ459808 mRNA Translation: CAD30851.1
AY197371 mRNA Translation: AAO27363.1
AB018287 mRNA Translation: BAA34464.2 Different initiation.
AK297404 mRNA Translation: BAH12570.1
AK304298 mRNA Translation: BAH14153.1
AK304343 mRNA Translation: BAH14164.1
AK304410 mRNA Translation: BAH14176.1
AC002088 Genomic DNA No translation available.
AC002124 Genomic DNA No translation available.
AC002410 Genomic DNA No translation available.
AC002433 Genomic DNA No translation available.
AC004744 Genomic DNA No translation available.
AC004994 Genomic DNA No translation available.
AC005249 Genomic DNA No translation available.
AC010082 Genomic DNA No translation available.
AC074193 Genomic DNA No translation available.
AC091697 Genomic DNA No translation available.
CH471073 Genomic DNA Translation: EAW93702.1
CH471073 Genomic DNA Translation: EAW93703.1
BC111735 mRNA Translation: AAI11736.1 Frameshift.
BC150328 mRNA Translation: AAI50329.1
BC152405 mRNA Translation: AAI52406.1
AF124924 mRNA Translation: AAF04254.1
CCDSiCCDS47553.1 [Q9UKV0-7]
CCDS47554.1 [Q9UKV0-5]
CCDS47555.1 [Q9UKV0-1]
CCDS47557.1 [Q9UKV0-3]
CCDS56465.1 [Q9UKV0-8]
CCDS56466.1 [Q9UKV0-9]
CCDS56467.1 [Q9UKV0-10]
CCDS56468.1 [Q9UKV0-11]
CCDS83163.1 [Q9UKV0-6]
RefSeqiNP_001191073.1, NM_001204144.2 [Q9UKV0-8]
NP_001191074.1, NM_001204145.2 [Q9UKV0-9]
NP_001191075.1, NM_001204146.2
NP_001191076.1, NM_001204147.2 [Q9UKV0-11]
NP_001191077.1, NM_001204148.2 [Q9UKV0-10]
NP_001308797.1, NM_001321868.1
NP_001308798.1, NM_001321869.1
NP_001308799.1, NM_001321870.1
NP_001308800.1, NM_001321871.1
NP_001308801.1, NM_001321872.1
NP_001308802.1, NM_001321873.1
NP_001308803.1, NM_001321874.1
NP_001308804.1, NM_001321875.1
NP_001308805.1, NM_001321876.1
NP_001308806.1, NM_001321877.1 [Q9UKV0-6]
NP_001308807.1, NM_001321878.1
NP_001308808.1, NM_001321879.1
NP_001308813.1, NM_001321884.1
NP_001308814.1, NM_001321885.1
NP_001308815.1, NM_001321886.1
NP_001308816.1, NM_001321887.1
NP_001308817.1, NM_001321888.1
NP_001308818.1, NM_001321889.1
NP_001308819.1, NM_001321890.1
NP_001308820.1, NM_001321891.1 [Q9UKV0-9]
NP_001308822.1, NM_001321893.1 [Q9UKV0-9]
NP_001308823.1, NM_001321894.1
NP_001308824.1, NM_001321895.1
NP_001308825.1, NM_001321896.1 [Q9UKV0-10]
NP_001308826.1, NM_001321897.1 [Q9UKV0-6]
NP_001308827.1, NM_001321898.1
NP_001308828.1, NM_001321899.1
NP_001308829.1, NM_001321900.1 [Q9UKV0-3]
NP_001308830.1, NM_001321901.1
NP_001308831.1, NM_001321902.1
NP_055522.1, NM_014707.3 [Q9UKV0-3]
NP_478056.1, NM_058176.2 [Q9UKV0-1]
NP_848510.1, NM_178423.2 [Q9UKV0-5]
NP_848512.1, NM_178425.3 [Q9UKV0-7]
XP_011513940.1, XM_011515638.2
XP_011513941.1, XM_011515639.2
XP_016868315.1, XM_017012826.1
XP_016868317.1, XM_017012828.1
UniGeneiHs.196054
Hs.444785

3D structure databases

ProteinModelPortaliQ9UKV0
SMRiQ9UKV0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115083, 59 interactors
DIPiDIP-39904N
ELMiQ9UKV0
IntActiQ9UKV0, 29 interactors
STRINGi9606.ENSP00000408617

Chemistry databases

BindingDBiQ9UKV0
ChEMBLiCHEMBL4145
DrugBankiDB05015 Belinostat
DB06603 Panobinostat
DB00313 Valproic Acid
GuidetoPHARMACOLOGYi2620

PTM databases

iPTMnetiQ9UKV0
PhosphoSitePlusiQ9UKV0

Polymorphism and mutation databases

BioMutaiHDAC9
DMDMi19865267

Proteomic databases

PaxDbiQ9UKV0
PeptideAtlasiQ9UKV0
PRIDEiQ9UKV0
ProteomicsDBi84881
84882 [Q9UKV0-2]
84883 [Q9UKV0-3]
84884 [Q9UKV0-4]
84885 [Q9UKV0-5]
84886 [Q9UKV0-6]
84887 [Q9UKV0-7]
84888 [Q9UKV0-8]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9734
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000401921; ENSP00000383912; ENSG00000048052 [Q9UKV0-6]
ENST00000405010; ENSP00000384382; ENSG00000048052 [Q9UKV0-3]
ENST00000406451; ENSP00000384657; ENSG00000048052 [Q9UKV0-5]
ENST00000417496; ENSP00000401669; ENSG00000048052 [Q9UKV0-8]
ENST00000428307; ENSP00000395655; ENSG00000048052 [Q9UKV0-9]
ENST00000432645; ENSP00000410337; ENSG00000048052 [Q9UKV0-1]
ENST00000441542; ENSP00000408617; ENSG00000048052 [Q9UKV0-7]
ENST00000456174; ENSP00000388568; ENSG00000048052 [Q9UKV0-10]
ENST00000524023; ENSP00000430036; ENSG00000048052 [Q9UKV0-11]
GeneIDi9734
KEGGihsa:9734
UCSCiuc003sud.2 human [Q9UKV0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9734
DisGeNETi9734
EuPathDBiHostDB:ENSG00000048052.21

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HDAC9
HGNCiHGNC:14065 HDAC9
HPAiHPA028926
MIMi606543 gene
neXtProtiNX_Q9UKV0
OpenTargetsiENSG00000048052
PharmGKBiPA38377

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1343 Eukaryota
COG0123 LUCA
GeneTreeiENSGT00940000160307
HOGENOMiHOG000232065
HOVERGENiHBG057100
InParanoidiQ9UKV0
KOiK11409
OMAiGAHKLPR
OrthoDBiEOG091G0EQO
PhylomeDBiQ9UKV0
TreeFamiTF106174

Enzyme and pathway databases

BRENDAi3.5.1.98 2681
ReactomeiR-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-2644606 Constitutive Signaling by NOTCH1 PEST Domain Mutants
R-HSA-2894862 Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
SIGNORiQ9UKV0

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HDAC9 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
HDAC9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9734

Protein Ontology

More...
PROi
PR:Q9UKV0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000048052 Expressed in 217 organ(s), highest expression level in corpus callosum
CleanExiHS_HDAC7
HS_HDAC9
ExpressionAtlasiQ9UKV0 baseline and differential
GenevisibleiQ9UKV0 HS

Family and domain databases

Gene3Di3.40.800.20, 1 hit
InterProiView protein in InterPro
IPR000286 His_deacetylse
IPR023801 His_deacetylse_dom
IPR037138 His_deacetylse_dom_sf
IPR024643 Hist_deacetylase_Gln_rich_N
IPR017320 Histone_deAcase_II_euk
IPR023696 Ureohydrolase_dom_sf
PANTHERiPTHR10625 PTHR10625, 1 hit
PfamiView protein in Pfam
PF12203 HDAC4_Gln, 1 hit
PF00850 Hist_deacetyl, 1 hit
PIRSFiPIRSF037911 HDAC_II_euk, 1 hit
PRINTSiPR01270 HDASUPER
SUPFAMiSSF52768 SSF52768, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHDAC9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UKV0
Secondary accession number(s): A7E2F3
, B7Z4I4, B7Z917, B7Z928, B7Z940, C9JS87, E7EX34, F8W9E0, O94845, O95028, Q2M2R6, Q86SL1, Q86US3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 18, 2001
Last modified: December 5, 2018
This is version 183 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again