Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 181 (07 Oct 2020)
Sequence version 4 (06 Mar 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Long-chain-fatty-acid--CoA ligase 6

Gene

ACSL6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the conversion of long-chain fatty acids to their active form acyl-CoA for both synthesis of cellular lipids, and degradation via beta-oxidation (PubMed:22633490, PubMed:24269233). Plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLigase
Biological processFatty acid metabolism, Lipid metabolism
LigandATP-binding, Magnesium, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS15193-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
6.2.1.3, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9UKU0

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-75876, Synthesis of very long-chain fatty acyl-CoAs

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000203

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Long-chain-fatty-acid--CoA ligase 6Curated (EC:6.2.1.32 Publications)
Alternative name(s):
Arachidonate--CoA ligaseCurated (EC:6.2.1.15By similarity)
Long-chain acyl-CoA synthetase 6
Short name:
LACS 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACSL6Imported
Synonyms:ACS2, FACL6, KIAA0837, LACS5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164398.12
HostDB:ENSG00000281938.1

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16496, ACSL6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604443, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UKU0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei25 – 45Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini46 – 697CytoplasmicSequence analysisAdd BLAST652

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome, Mitochondrion, Mitochondrion outer membrane, Peroxisome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving ACSL6 may be a cause of myelodysplastic syndrome with basophilia. Translocation t(5;12)(q31;p13) with ETV6.1 Publication
A chromosomal aberration involving ACSL6 may be a cause of acute myelogenous leukemia with eosinophilia. Translocation t(5;12)(q31;p13) with ETV6.1 Publication
A chromosomal aberration involving ACSL6 may be a cause of acute eosinophilic leukemia (AEL). Translocation t(5;12)(q31;p13) with ETV6.1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
23305

Open Targets

More...
OpenTargetsi
ENSG00000164398

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27970

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UKU0, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ACSL6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
146322303

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001931151 – 697Long-chain-fatty-acid--CoA ligase 6Add BLAST697

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UKU0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UKU0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9UKU0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UKU0

PeptideAtlas

More...
PeptideAtlasi
Q9UKU0

PRoteomics IDEntifications database

More...
PRIDEi
Q9UKU0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
84870 [Q9UKU0-4]
84871 [Q9UKU0-1]
84872 [Q9UKU0-2]
84873 [Q9UKU0-3]
84874 [Q9UKU0-5]
84875 [Q9UKU0-6]
84876 [Q9UKU0-7]
84877 [Q9UKU0-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UKU0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UKU0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in erythrocyte precursors, in particular in reticulocytes, fetal blood cells derived from fetal liver, hemopoietic stem cells from cord blood, bone marrow and brain.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression is low at earlier stages of erythroid development but is very high in reticulocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164398, Expressed in corpus callosum and 167 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UKU0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UKU0, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000164398, Tissue enhanced (brain, ductus deferens, seminal vesicle, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116897, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UKU0, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000368566

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UKU0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UKU0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1256, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162308

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000022_45_4_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UKU0

KEGG Orthology (KO)

More...
KOi
K01897

Identification of Orthologs from Complete Genome Data

More...
OMAi
IAKCPIV

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UKU0

TreeFam database of animal gene trees

More...
TreeFami
TF313877

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.12780, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025110, AMP-bd_C
IPR020845, AMP-binding_CS
IPR000873, AMP-dep_Synth/Lig
IPR042099, AMP-dep_Synthh-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00501, AMP-binding, 1 hit
PF13193, AMP-binding_C, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00455, AMP_BINDING, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 4 (identifier: Q9UKU0-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQTQEILRIL RLPELGDLGQ FFRSLSATTL VSMGALAAIL AYWFTHRPKA
60 70 80 90 100
LQPPCNLLMQ SEEVEDSGGA RRSVIGSGPQ LLTHYYDDAR TMYQVFRRGL
110 120 130 140 150
SISGNGPCLG FRKPKQPYQW LSYQEVADRA EFLGSGLLQH NCKACTDQFI
160 170 180 190 200
GVFAQNRPEW IIVELACYTY SMVVVPLYDT LGPGAIRYII NTADISTVIV
210 220 230 240 250
DKPQKAVLLL EHVERKETPG LKLIILMDPF EEALKERGQK CGVVIKSMQA
260 270 280 290 300
VEDCGQENHQ APVPPQPDDL SIVCFTSGTT GNPKGAMLTH GNVVADFSGF
310 320 330 340 350
LKVTEKVIFP RQDDVLISFL PLAHMFERVI QSVVYCHGGR VGFFQGDIRL
360 370 380 390 400
LSDDMKALCP TIFPVVPRLL NRMYDKIFSQ ANTPLKRWLL EFAAKRKQAE
410 420 430 440 450
VRSGIIRNDS IWDELFFNKI QASLGGCVRM IVTGAAPASP TVLGFLRAAL
460 470 480 490 500
GCQVYEGYGQ TECTAGCTFT TPGDWTSGHV GAPLPCNHIK LVDVEELNYW
510 520 530 540 550
ACKGEGEICV RGPNVFKGYL KDPDRTKEAL DSDGWLHTGD IGKWLPAGTL
560 570 580 590 600
KIIDRKKHIF KLAQGEYVAP EKIENIYIRS QPVAQIYVHG DSLKAFLVGI
610 620 630 640 650
VVPDPEVMPS WAQKRGIEGT YADLCTNKDL KKAILEDMVR LGKESGLHSF
660 670 680 690
EQVKAIHIHS DMFSVQNGLL TPTLKAKRPE LREYFKKQIE ELYSISM
Length:697
Mass (Da):77,752
Last modified:March 6, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAC566177B47D0975
GO
Isoform 1 (identifier: Q9UKU0-1) [UniParc]FASTAAdd to basket
Also known as: Long, v2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLTFFLVSGGSLWLFVEFVLSLLEKM

Show »
Length:722
Mass (Da):80,610
Checksum:i2B7D408F2F77C1FB
GO
Isoform 2 (identifier: Q9UKU0-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     306-330: KVIFPRQDDVLISFLPLAHMFERVI → SQWAPTCADVHISYLPLAHMFERMV
     653-697: VKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM → DLPQCLIQIKVFSKY

Show »
Length:667
Mass (Da):74,175
Checksum:iE57CDD86836E7D64
GO
Isoform 3 (identifier: Q9UKU0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     306-330: KVIFPRQDDVLISFLPLAHMFERVI → SQWAPTCADVHISYLPLAHMFERMV

Show »
Length:697
Mass (Da):77,671
Checksum:iF70642502C212FA7
GO
Isoform 5 (identifier: Q9UKU0-5) [UniParc]FASTAAdd to basket
Also known as: v4

The sequence of this isoform differs from the canonical sequence as follows:
     306-312: Missing.

Show »
Length:690
Mass (Da):76,883
Checksum:i3D96A1B1433CF6F9
GO
Isoform 6 (identifier: Q9UKU0-6) [UniParc]FASTAAdd to basket
Also known as: v5

The sequence of this isoform differs from the canonical sequence as follows:
     192-192: T → TGLSCQEGASATASTQ

Show »
Length:712
Mass (Da):79,144
Checksum:i1BC1636243762146
GO
Isoform 7 (identifier: Q9UKU0-7) [UniParc]FASTAAdd to basket
Also known as: v3

The sequence of this isoform differs from the canonical sequence as follows:
     31-65: Missing.
     306-345: Missing.

Show »
Length:622
Mass (Da):69,222
Checksum:iE5BE0D13E92599ED
GO
Isoform 8 (identifier: Q9UKU0-8) [UniParc]FASTAAdd to basket
Also known as: v1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLTFFLVSGGSLWLFVEFVLSLLEKM
     306-330: KVIFPRQDDVLISFLPLAHMFERVI → SQWAPTCADVHISYLPLAHMFERMV

Show »
Length:722
Mass (Da):80,529
Checksum:i702D63A8B72BE729
GO
Isoform 9 (identifier: Q9UKU0-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPEFVLSLLEKM

Show »
Length:708
Mass (Da):79,040
Checksum:iDD0FE6A5EDA476D0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A494C0B6A0A494C0B6_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
720Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A499FJL5A0A499FJL5_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
710Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C005A0A494C005_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
332Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C0A5A0A494C0A5_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
338Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8C7C9J8C7_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
687Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3Z0C9J3Z0_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ERD7E7ERD7_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
677Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494BZW8A0A494BZW8_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
662Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C0J9A0A494C0J9_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
669Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JK59C9JK59_HUMAN
Long-chain-fatty-acid--CoA ligase 6
ACSL6
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH26161 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence BAA74860 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti19G → E in AAD47199 (PubMed:10548543).Curated1
Sequence conflicti46H → Q in AAD47199 (PubMed:10548543).Curated1
Sequence conflicti257E → A in AAH47453 (PubMed:15489334).Curated1
Sequence conflicti260Q → L in AAH26161 (PubMed:15489334).Curated1
Sequence conflicti356K → R in AAZ30714 (PubMed:16834775).Curated1
Sequence conflicti696S → P in AAD47199 (PubMed:10548543).Curated1
Sequence conflicti696S → P in AAZ30714 (PubMed:16834775).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0378191M → MLTFFLVSGGSLWLFVEFVL SLLEKM in isoform 1 and isoform 8. 1 Publication1
Alternative sequenceiVSP_0469541M → MPEFVLSLLEKM in isoform 9. 1 Publication1
Alternative sequenceiVSP_03782031 – 65Missing in isoform 7. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_037821192T → TGLSCQEGASATASTQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_037822306 – 345Missing in isoform 7. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_021024306 – 330KVIFP…FERVI → SQWAPTCADVHISYLPLAHM FERMV in isoform 3, isoform 2 and isoform 8. 2 PublicationsAdd BLAST25
Alternative sequenceiVSP_037823306 – 312Missing in isoform 5. 1 Publication7
Alternative sequenceiVSP_000241653 – 697VKAIH…YSISM → DLPQCLIQIKVFSKY in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF129166 mRNA Translation: AAD47199.1
AF099740 mRNA Translation: AAD17853.1
DQ083030 mRNA Translation: AAZ30713.1
DQ083031 mRNA Translation: AAZ30714.1
AB020644 mRNA Translation: BAA74860.1 Different initiation.
CR606980 mRNA No translation available.
AC025772 Genomic DNA No translation available.
AC026398 Genomic DNA No translation available.
AC034228 Genomic DNA No translation available.
BC026161 mRNA Translation: AAH26161.1 Sequence problems.
BC047453 mRNA Translation: AAH47453.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34228.1 [Q9UKU0-8]
CCDS34229.1 [Q9UKU0-1]
CCDS56381.1 [Q9UKU0-3]
CCDS56382.1 [Q9UKU0-7]
CCDS56383.1 [Q9UKU0-9]

NCBI Reference Sequences

More...
RefSeqi
NP_001009185.1, NM_001009185.2 [Q9UKU0-1]
NP_001192176.1, NM_001205247.1
NP_001192177.1, NM_001205248.1 [Q9UKU0-3]
NP_001192179.1, NM_001205250.1 [Q9UKU0-9]
NP_001192180.1, NM_001205251.1 [Q9UKU0-7]
NP_056071.2, NM_015256.3 [Q9UKU0-8]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000357096; ENSP00000349608; ENSG00000164398 [Q9UKU0-7]
ENST00000379240; ENSP00000368542; ENSG00000164398 [Q9UKU0-4]
ENST00000379244; ENSP00000368546; ENSG00000164398 [Q9UKU0-3]
ENST00000379246; ENSP00000368548; ENSG00000164398 [Q9UKU0-9]
ENST00000379255; ENSP00000368557; ENSG00000164398 [Q9UKU0-7]
ENST00000543479; ENSP00000442124; ENSG00000164398 [Q9UKU0-6]
ENST00000651356; ENSP00000498260; ENSG00000164398 [Q9UKU0-8]
ENST00000651883; ENSP00000499063; ENSG00000164398 [Q9UKU0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23305

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23305

UCSC genome browser

More...
UCSCi
uc003kvv.3, human [Q9UKU0-4]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF129166 mRNA Translation: AAD47199.1
AF099740 mRNA Translation: AAD17853.1
DQ083030 mRNA Translation: AAZ30713.1
DQ083031 mRNA Translation: AAZ30714.1
AB020644 mRNA Translation: BAA74860.1 Different initiation.
CR606980 mRNA No translation available.
AC025772 Genomic DNA No translation available.
AC026398 Genomic DNA No translation available.
AC034228 Genomic DNA No translation available.
BC026161 mRNA Translation: AAH26161.1 Sequence problems.
BC047453 mRNA Translation: AAH47453.1
CCDSiCCDS34228.1 [Q9UKU0-8]
CCDS34229.1 [Q9UKU0-1]
CCDS56381.1 [Q9UKU0-3]
CCDS56382.1 [Q9UKU0-7]
CCDS56383.1 [Q9UKU0-9]
RefSeqiNP_001009185.1, NM_001009185.2 [Q9UKU0-1]
NP_001192176.1, NM_001205247.1
NP_001192177.1, NM_001205248.1 [Q9UKU0-3]
NP_001192179.1, NM_001205250.1 [Q9UKU0-9]
NP_001192180.1, NM_001205251.1 [Q9UKU0-7]
NP_056071.2, NM_015256.3 [Q9UKU0-8]

3D structure databases

SMRiQ9UKU0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116897, 3 interactors
IntActiQ9UKU0, 4 interactors
STRINGi9606.ENSP00000368566

Chemistry databases

SwissLipidsiSLP:000000203

PTM databases

iPTMnetiQ9UKU0
PhosphoSitePlusiQ9UKU0

Polymorphism and mutation databases

BioMutaiACSL6
DMDMi146322303

Proteomic databases

jPOSTiQ9UKU0
MassIVEiQ9UKU0
MaxQBiQ9UKU0
PaxDbiQ9UKU0
PeptideAtlasiQ9UKU0
PRIDEiQ9UKU0
ProteomicsDBi84870 [Q9UKU0-4]
84871 [Q9UKU0-1]
84872 [Q9UKU0-2]
84873 [Q9UKU0-3]
84874 [Q9UKU0-5]
84875 [Q9UKU0-6]
84876 [Q9UKU0-7]
84877 [Q9UKU0-8]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25915, 184 antibodies

The DNASU plasmid repository

More...
DNASUi
23305

Genome annotation databases

EnsembliENST00000357096; ENSP00000349608; ENSG00000164398 [Q9UKU0-7]
ENST00000379240; ENSP00000368542; ENSG00000164398 [Q9UKU0-4]
ENST00000379244; ENSP00000368546; ENSG00000164398 [Q9UKU0-3]
ENST00000379246; ENSP00000368548; ENSG00000164398 [Q9UKU0-9]
ENST00000379255; ENSP00000368557; ENSG00000164398 [Q9UKU0-7]
ENST00000543479; ENSP00000442124; ENSG00000164398 [Q9UKU0-6]
ENST00000651356; ENSP00000498260; ENSG00000164398 [Q9UKU0-8]
ENST00000651883; ENSP00000499063; ENSG00000164398 [Q9UKU0-1]
GeneIDi23305
KEGGihsa:23305
UCSCiuc003kvv.3, human [Q9UKU0-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23305
DisGeNETi23305
EuPathDBiHostDB:ENSG00000164398.12
HostDB:ENSG00000281938.1

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ACSL6
HGNCiHGNC:16496, ACSL6
HPAiENSG00000164398, Tissue enhanced (brain, ductus deferens, seminal vesicle, testis)
MIMi604443, gene
neXtProtiNX_Q9UKU0
OpenTargetsiENSG00000164398
PharmGKBiPA27970

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1256, Eukaryota
GeneTreeiENSGT00940000162308
HOGENOMiCLU_000022_45_4_1
InParanoidiQ9UKU0
KOiK01897
OMAiIAKCPIV
PhylomeDBiQ9UKU0
TreeFamiTF313877

Enzyme and pathway databases

BioCyciMetaCyc:HS15193-MONOMER
BRENDAi6.2.1.3, 2681
PathwayCommonsiQ9UKU0
ReactomeiR-HSA-75876, Synthesis of very long-chain fatty acyl-CoAs

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23305, 2 hits in 872 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ACSL6, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ACSL6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23305
PharosiQ9UKU0, Tbio

Protein Ontology

More...
PROi
PR:Q9UKU0
RNActiQ9UKU0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164398, Expressed in corpus callosum and 167 other tissues
ExpressionAtlasiQ9UKU0, baseline and differential
GenevisibleiQ9UKU0, HS

Family and domain databases

Gene3Di3.40.50.12780, 2 hits
InterProiView protein in InterPro
IPR025110, AMP-bd_C
IPR020845, AMP-binding_CS
IPR000873, AMP-dep_Synth/Lig
IPR042099, AMP-dep_Synthh-like_sf
PfamiView protein in Pfam
PF00501, AMP-binding, 1 hit
PF13193, AMP-binding_C, 1 hit
PROSITEiView protein in PROSITE
PS00455, AMP_BINDING, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACSL6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UKU0
Secondary accession number(s): J3KPG3
, O94924, O95829, Q108M9, Q108N0, Q4G191, Q86TN7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 6, 2007
Last modified: October 7, 2020
This is version 181 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again