Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (12 Aug 2020)
Sequence version 2 (05 May 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

A disintegrin and metalloproteinase with thrombospondin motifs 6

Gene

ADAMTS6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi403Zinc; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei404PROSITE-ProRule annotation1
Metal bindingi407Zinc; catalyticBy similarity1
Metal bindingi413Zinc; catalyticBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9UKP5

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5083635, Defective B3GALTL causes Peters-plus syndrome (PpS)
R-HSA-5173214, O-glycosylation of TSR domain-containing proteins

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M12.230

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
A disintegrin and metalloproteinase with thrombospondin motifs 6 (EC:3.4.24.-)
Short name:
ADAM-TS 6
Short name:
ADAM-TS6
Short name:
ADAMTS-6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAMTS6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000049192.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:222, ADAMTS6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605008, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UKP5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
11174

Open Targets

More...
OpenTargetsi
ENSG00000049192

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24550

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UKP5, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ADAMTS6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
229462816

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002917422 – 244By similarityAdd BLAST223
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000029175245 – 1117A disintegrin and metalloproteinase with thrombospondin motifs 6Add BLAST873

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi99N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi172N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi222N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi234N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi326 ↔ 387By similarity
Disulfide bondi362 ↔ 369By similarity
Disulfide bondi381 ↔ 463By similarity
Disulfide bondi420 ↔ 447By similarity
Disulfide bondi490 ↔ 512By similarity
Disulfide bondi501 ↔ 519By similarity
Disulfide bondi507 ↔ 542By similarity
Disulfide bondi532 ↔ 547By similarity
Disulfide bondi570 ↔ 607By similarity
Disulfide bondi574 ↔ 612By similarity
Disulfide bondi585 ↔ 597By similarity
Glycosylationi724N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi911 ↔ 954By similarity
Disulfide bondi915 ↔ 959By similarity
Disulfide bondi926 ↔ 943By similarity
Glycosylationi956N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity
Glycosylated. Can be O-fucosylated by POFUT2 on a serine or a threonine residue found within the consensus sequence C1-X2-(S/T)-C2-G of the TSP type-1 repeat domains where C1 and C2 are the first and second cysteine residue of the repeat, respectively. Fucosylated repeats can then be further glycosylated by the addition of a beta-1,3-glucose residue by the glucosyltransferase, B3GALTL. Fucosylation mediates the efficient secretion of ADAMTS family members. Also can be C-glycosylated with one or two mannose molecules on tryptophan residues within the consensus sequence W-X-X-W of the TPRs, and N-glycosylated. These other glycosylations can also facilitate secretion (By similarity).By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UKP5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UKP5

PeptideAtlas

More...
PeptideAtlasi
Q9UKP5

PRoteomics IDEntifications database

More...
PRIDEi
Q9UKP5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
84829 [Q9UKP5-1]
84830 [Q9UKP5-2]
84831 [Q9UKP5-3]
84832 [Q9UKP5-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9UKP5, 6 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UKP5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UKP5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at low levels in placenta and barely detectable in a number of other tissues.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 1 and isoform 2 expressions are up-regulated by TNF in retinal pigment epithelial cells.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000049192, Expressed in amniotic fluid and 149 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UKP5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000049192, Tissue enriched (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116345, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UKP5, 2 interactors

Molecular INTeraction database

More...
MINTi
Q9UKP5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000370443

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UKP5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UKP5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini250 – 468Peptidase M12BPROSITE-ProRule annotationAdd BLAST219
Domaini495 – 557DisintegrinAdd BLAST63
Domaini558 – 613TSP type-1 1PROSITE-ProRule annotationAdd BLAST56
Domaini840 – 900TSP type-1 2PROSITE-ProRule annotationAdd BLAST61
Domaini902 – 960TSP type-1 3PROSITE-ProRule annotationAdd BLAST59
Domaini962 – 1007TSP type-1 4PROSITE-ProRule annotationAdd BLAST46
Domaini1018 – 1073TSP type-1 5PROSITE-ProRule annotationAdd BLAST56
Domaini1079 – 1117PLACPROSITE-ProRule annotationAdd BLAST39

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni717 – 843SpacerAdd BLAST127

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3538, Eukaryota
KOG4597, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156571

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000660_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UKP5

KEGG Orthology (KO)

More...
KOi
K08621

Identification of Orthologs from Complete Genome Data

More...
OMAi
GTWPQSV

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UKP5

TreeFam database of animal gene trees

More...
TreeFami
TF313537

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.20.100.10, 5 hits
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041645, ADAM_CR_2
IPR010294, ADAM_spacer1
IPR013273, ADAMTS/ADAMTS-like
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR010909, PLAC
IPR000884, TSP1_rpt
IPR036383, TSP1_rpt_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17771, ADAM_CR_2, 1 hit
PF05986, ADAM_spacer1, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF08686, PLAC, 1 hit
PF01421, Reprolysin, 1 hit
PF00090, TSP_1, 5 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01857, ADAMTSFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00209, TSP1, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF82895, SSF82895, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS50900, PLAC, 1 hit
PS50092, TSP1, 4 hits
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9UKP5-1) [UniParc]FASTAAdd to basket
Also known as: Variant 2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEILWKTLTW ILSLIMASSE FHSDHRLSYS SQEEFLTYLE HYQLTIPIRV
60 70 80 90 100
DQNGAFLSFT VKNDKHSRRR RSMDPIDPQQ AVSKLFFKLS AYGKHFHLNL
110 120 130 140 150
TLNTDFVSKH FTVEYWGKDG PQWKHDFLDN CHYTGYLQDQ RSTTKVALSN
160 170 180 190 200
CVGLHGVIAT EDEEYFIEPL KNTTEDSKHF SYENGHPHVI YKKSALQQRH
210 220 230 240 250
LYDHSHCGVS DFTRSGKPWW LNDTSTVSYS LPINNTHIHH RQKRSVSIER
260 270 280 290 300
FVETLVVADK MMVGYHGRKD IEHYILSVMN IVAKLYRDSS LGNVVNIIVA
310 320 330 340 350
RLIVLTEDQP NLEINHHADK SLDSFCKWQK SILSHQSDGN TIPENGIAHH
360 370 380 390 400
DNAVLITRYD ICTYKNKPCG TLGLASVAGM CEPERSCSIN EDIGLGSAFT
410 420 430 440 450
IAHEIGHNFG MNHDGIGNSC GTKGHEAAKL MAAHITANTN PFSWSACSRD
460 470 480 490 500
YITSFLDSGR GTCLDNEPPK RDFLYPAVAP GQVYDADEQC RFQYGATSRQ
510 520 530 540 550
CKYGEVCREL WCLSKSNRCV TNSIPAAEGT LCQTGNIEKG WCYQGDCVPF
560 570 580 590 600
GTWPQSIDGG WGPWSLWGEC SRTCGGGVSS SLRHCDSPAP SGGGKYCLGE
610 620 630 640 650
RKRYRSCNTD PCPLGSRDFR EKQCADFDNM PFRGKYYNWK PYTGGGVKPC
660 670 680 690 700
ALNCLAEGYN FYTERAPAVI DGTQCNADSL DICINGECKH VGCDNILGSD
710 720 730 740 750
AREDRCRVCG GDGSTCDAIE GFFNDSLPRG GYMEVVQIPR GSVHIEVREV
760 770 780 790 800
AMSKNYIALK SEGDDYYING AWTIDWPRKF DVAGTAFHYK RPTDEPESLE
810 820 830 840 850
ALGPTSENLI VMVLLQEQNL GIRYKFNVPI TRTGSGDNEV GFTWNHQPWS
860 870 880 890 900
ECSATCAGGV QRQEVVCKRL DDNSIVQNNY CDPDSKPPEN QRACNTEPCP
910 920 930 940 950
PEWFIGDWLE CSKTCDGGMR TRAVLCIRKI GPSEEETLDY SGCLTHRPVE
960 970 980 990 1000
KEPCNNQSCP PQWVALDWSE CTPKCGPGFK HRIVLCKSSD LSKTFPAAQC
1010 1020 1030 1040 1050
PEESKPPVRI RCSLGRCPPP RWVTGDWGQC SAQCGLGQQM RTVQCLSYTG
1060 1070 1080 1090 1100
QASSDCLETV RPPSMQQCES KCDSTPISNT EECKDVNKVA YCPLVLKFKF
1110
CSRAYFRQMC CKTCQGH
Length:1,117
Mass (Da):125,273
Last modified:May 5, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5901E86BC82A9A87
GO
Isoform 2 (identifier: Q9UKP5-2) [UniParc]FASTAAdd to basket
Also known as: Variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     422-504: TKGHEAAKLM...GATSRQCKYG → RKVMKQQNYGSSHYCEYQSFFLVCLQSRFHHQLFR
     860-908: VQRQEVVCKR...CPPEWFIGDW → KMPTRQPTQR...SCNLAKETLL
     909-1117: Missing.

Note: Contains critical point mutations in the region encoding the catalytic domain as well as 2 point mutations compared with genomic sequence. May either be a rare polymorphism or may have arisen through a combination of aberrant RNA editing and point mutation/sequencing error.Curated
Show »
Length:860
Mass (Da):97,152
Checksum:iEA137275B9A465C2
GO
Isoform 3 (identifier: Q9UKP5-3) [UniParc]FASTAAdd to basket
Also known as: Variant 3

The sequence of this isoform differs from the canonical sequence as follows:
     457-468: DSGRGTCLDNEP → EFLKLGDSISGS
     469-1117: Missing.

Show »
Length:468
Mass (Da):53,165
Checksum:iE8D2E75EF8A1C468
GO
Isoform 4 (identifier: Q9UKP5-4) [UniParc]FASTAAdd to basket
Also known as: Variant 4

The sequence of this isoform differs from the canonical sequence as follows:
     283-292: AKLYRDSSLG → RLPNFTVIPA
     293-1117: Missing.

Show »
Length:292
Mass (Da):34,189
Checksum:i01A54680DCEFABD7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti4L → S in AAW47399 (PubMed:16129570).Curated1
Sequence conflicti24D → G in AAW47398 (PubMed:16129570).Curated1
Sequence conflicti83S → P in AAW47398 (PubMed:16129570).Curated1
Sequence conflicti229Y → H in AAW47397 (PubMed:16129570).Curated1
Sequence conflicti406G → V in AAD56357 (PubMed:10464288).Curated1
Sequence conflicti426E → G in AAD56357 (PubMed:10464288).Curated1
Sequence conflicti426E → G in AAW47397 (PubMed:16129570).Curated1
Sequence conflicti588 – 589PA → LK in BAD92922 (Ref. 4) Curated2
Sequence conflicti712D → G in AAD56357 (PubMed:10464288).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_037093283 – 292AKLYRDSSLG → RLPNFTVIPA in isoform 4. 1 Publication10
Alternative sequenceiVSP_037094293 – 1117Missing in isoform 4. 1 PublicationAdd BLAST825
Alternative sequenceiVSP_037095422 – 504TKGHE…QCKYG → RKVMKQQNYGSSHYCEYQSF FLVCLQSRFHHQLFR in isoform 2. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_037096457 – 468DSGRG…LDNEP → EFLKLGDSISGS in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037097469 – 1117Missing in isoform 3. 1 PublicationAdd BLAST649
Alternative sequenceiVSP_037098860 – 908VQRQE…FIGDW → KMPTRQPTQRARWRTKHILS YALCLLKKLIGNISCRFASS CNLAKETLL in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_037099909 – 1117Missing in isoform 2. 1 PublicationAdd BLAST209

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF140674 mRNA Translation: AAD56357.1
AY692424 mRNA Translation: AAW47397.1
AY692425 mRNA Translation: AAW47398.1
AY692426 mRNA Translation: AAW47399.1
AC008847 Genomic DNA No translation available.
AC008868 Genomic DNA No translation available.
AC025176 Genomic DNA No translation available.
AC025186 Genomic DNA No translation available.
AC099505 Genomic DNA No translation available.
AB209685 mRNA Translation: BAD92922.1
CR749356 mRNA Translation: CAH18209.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3983.2 [Q9UKP5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_922932.2, NM_197941.3 [Q9UKP5-1]
XP_011541415.1, XM_011543113.2 [Q9UKP5-1]
XP_011541416.1, XM_011543114.2 [Q9UKP5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000381052; ENSP00000424377; ENSG00000049192 [Q9UKP5-4]
ENST00000381055; ENSP00000370443; ENSG00000049192 [Q9UKP5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11174

UCSC genome browser

More...
UCSCi
uc003jtp.4, human [Q9UKP5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF140674 mRNA Translation: AAD56357.1
AY692424 mRNA Translation: AAW47397.1
AY692425 mRNA Translation: AAW47398.1
AY692426 mRNA Translation: AAW47399.1
AC008847 Genomic DNA No translation available.
AC008868 Genomic DNA No translation available.
AC025176 Genomic DNA No translation available.
AC025186 Genomic DNA No translation available.
AC099505 Genomic DNA No translation available.
AB209685 mRNA Translation: BAD92922.1
CR749356 mRNA Translation: CAH18209.1
CCDSiCCDS3983.2 [Q9UKP5-1]
RefSeqiNP_922932.2, NM_197941.3 [Q9UKP5-1]
XP_011541415.1, XM_011543113.2 [Q9UKP5-1]
XP_011541416.1, XM_011543114.2 [Q9UKP5-1]

3D structure databases

SMRiQ9UKP5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116345, 3 interactors
IntActiQ9UKP5, 2 interactors
MINTiQ9UKP5
STRINGi9606.ENSP00000370443

Protein family/group databases

MEROPSiM12.230

PTM databases

GlyGeniQ9UKP5, 6 sites
iPTMnetiQ9UKP5
PhosphoSitePlusiQ9UKP5

Polymorphism and mutation databases

BioMutaiADAMTS6
DMDMi229462816

Proteomic databases

MassIVEiQ9UKP5
PaxDbiQ9UKP5
PeptideAtlasiQ9UKP5
PRIDEiQ9UKP5
ProteomicsDBi84829 [Q9UKP5-1]
84830 [Q9UKP5-2]
84831 [Q9UKP5-3]
84832 [Q9UKP5-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
11532, 56 antibodies

Genome annotation databases

EnsembliENST00000381052; ENSP00000424377; ENSG00000049192 [Q9UKP5-4]
ENST00000381055; ENSP00000370443; ENSG00000049192 [Q9UKP5-1]
GeneIDi11174
KEGGihsa:11174
UCSCiuc003jtp.4, human [Q9UKP5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11174
DisGeNETi11174
EuPathDBiHostDB:ENSG00000049192.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ADAMTS6
HGNCiHGNC:222, ADAMTS6
HPAiENSG00000049192, Tissue enriched (placenta)
MIMi605008, gene
neXtProtiNX_Q9UKP5
OpenTargetsiENSG00000049192
PharmGKBiPA24550

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3538, Eukaryota
KOG4597, Eukaryota
GeneTreeiENSGT00940000156571
HOGENOMiCLU_000660_1_1_1
InParanoidiQ9UKP5
KOiK08621
OMAiGTWPQSV
PhylomeDBiQ9UKP5
TreeFamiTF313537

Enzyme and pathway databases

PathwayCommonsiQ9UKP5
ReactomeiR-HSA-5083635, Defective B3GALTL causes Peters-plus syndrome (PpS)
R-HSA-5173214, O-glycosylation of TSR domain-containing proteins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
11174, 3 hits in 853 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ADAMTS6, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11174
PharosiQ9UKP5, Tdark

Protein Ontology

More...
PROi
PR:Q9UKP5
RNActiQ9UKP5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000049192, Expressed in amniotic fluid and 149 other tissues
GenevisibleiQ9UKP5, HS

Family and domain databases

Gene3Di2.20.100.10, 5 hits
3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR041645, ADAM_CR_2
IPR010294, ADAM_spacer1
IPR013273, ADAMTS/ADAMTS-like
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR010909, PLAC
IPR000884, TSP1_rpt
IPR036383, TSP1_rpt_sf
PfamiView protein in Pfam
PF17771, ADAM_CR_2, 1 hit
PF05986, ADAM_spacer1, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF08686, PLAC, 1 hit
PF01421, Reprolysin, 1 hit
PF00090, TSP_1, 5 hits
PRINTSiPR01857, ADAMTSFAMILY
SMARTiView protein in SMART
SM00209, TSP1, 5 hits
SUPFAMiSSF82895, SSF82895, 5 hits
PROSITEiView protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS50900, PLAC, 1 hit
PS50092, TSP1, 4 hits
PS00142, ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATS6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UKP5
Secondary accession number(s): Q59EX6
, Q5IR87, Q5IR88, Q5IR89, Q68DL1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 5, 2009
Last modified: August 12, 2020
This is version 180 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again