Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (18 Sep 2019)
Sequence version 3 (16 Apr 2014)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cytoplasmic phosphatidylinositol transfer protein 1

Gene

PITPNC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processLipid transport, Transport
LigandLipid-binding

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000413
SLP:000000992 [Q9UKF7-1]
SLP:000000993 [Q9UKF7-2]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytoplasmic phosphatidylinositol transfer protein 1
Alternative name(s):
Mammalian rdgB homolog beta
Short name:
M-rdgB beta
Short name:
MrdgBbeta
Retinal degeneration B homolog beta
Short name:
RdgBbeta
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PITPNC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21045 PITPNC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605134 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UKF7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
26207

Open Targets

More...
OpenTargetsi
ENSG00000154217

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394642

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UKF7

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PITPNC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
147720965

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002875301 – 332Cytoplasmic phosphatidylinositol transfer protein 1Add BLAST332

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei119PhosphoserineBy similarity1
Modified residuei270PhosphoserineBy similarity1
Modified residuei274PhosphoserineBy similarity1
Modified residuei278PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UKF7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UKF7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UKF7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UKF7

PeptideAtlas

More...
PeptideAtlasi
Q9UKF7

PRoteomics IDEntifications database

More...
PRIDEi
Q9UKF7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
84783 [Q9UKF7-1]
84784 [Q9UKF7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UKF7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UKF7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000154217 Expressed in 212 organ(s), highest expression level in frontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UKF7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UKF7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026563
HPA031250

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117607, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UKF7, 21 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000464006

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UKF7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3668 Eukaryota
COG5083 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160720

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006717

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UKF7

Database of Orthologous Groups

More...
OrthoDBi
951268at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.530.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001666 PI_transfer
IPR023393 START-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10658 PTHR10658, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02121 IP_trans, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00391 PITRANSFER

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UKF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLLKEYRICM PLTVDEYKIG QLYMISKHSH EQSDRGEGVE VVQNEPFEDP
60 70 80 90 100
HHGNGQFTEK RVYLNSKLPS WARAVVPKIF YVTEKAWNYY PYTITEYTCS
110 120 130 140 150
FLPKFSIHIE TKYEDNKGSN DTIFDNEAKD VEREVCFIDI ACDEIPERYY
160 170 180 190 200
KESEDPKHFK SEKTGRGQLR EGWRDSHQPI MCSYKLVTVK FEVWGLQTRV
210 220 230 240 250
EQFVHKVVRD ILLIGHRQAF AWVDEWYDMT MDEVREFERA TQEATNKKIG
260 270 280 290 300
IFPPAISISS IPLLPSSVRS APSSAPSTPL STDAPEFLSV PKDRPRKKSA
310 320 330
PETLTLPDPE KKATLNLPGM HSSDKPCRPK SE
Length:332
Mass (Da):38,388
Last modified:April 16, 2014 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD42C8F00FFA54C6A
GO
Isoform 2 (identifier: Q9UKF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-332: FERATQEATN...SDKPCRPKSE → YEKNMHEQTNIKVCNQHSSPVDDIESHAQTST

Note: No experimental confirmation available.
Show »
Length:268
Mass (Da):31,783
Checksum:iC4CA9500EF02BBFF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QRS7J3QRS7_HUMAN
Cytoplasmic phosphatidylinositol tr...
PITPNC1
98Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QS95J3QS95_HUMAN
Cytoplasmic phosphatidylinositol tr...
PITPNC1
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGP0A0A0C4DGP0_HUMAN
Cytoplasmic phosphatidylinositol tr...
PITPNC1
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EU35E7EU35_HUMAN
Cytoplasmic phosphatidylinositol tr...
PITPNC1
266Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti18K → R in BAF83527 (PubMed:14702039).Curated1
Sequence conflicti126N → S in AAF06148 (PubMed:10531358).Curated1
Sequence conflicti191F → S in AAF06148 (PubMed:10531358).Curated1
Sequence conflicti233E → D in BAF83527 (PubMed:14702039).Curated1
Sequence conflicti233E → D in AAH07905 (PubMed:15489334).Curated1
Sequence conflicti233E → D in AAH67095 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_025545237 – 332FERAT…RPKSE → YEKNMHEQTNIKVCNQHSSP VDDIESHAQTST in isoform 2. 2 PublicationsAdd BLAST96

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF171102 mRNA Translation: AAF06148.1
AK290838 mRNA Translation: BAF83527.1
AC079331 Genomic DNA No translation available.
AC110921 Genomic DNA No translation available.
BC007905 mRNA Translation: AAH07905.1
BC067095 mRNA Translation: AAH67095.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58587.1 [Q9UKF7-2]
CCDS58588.1 [Q9UKF7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_036549.2, NM_012417.3 [Q9UKF7-1]
NP_858057.1, NM_181671.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000581322; ENSP00000464006; ENSG00000154217 [Q9UKF7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26207

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26207

UCSC genome browser

More...
UCSCi
uc002jgb.5 human [Q9UKF7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF171102 mRNA Translation: AAF06148.1
AK290838 mRNA Translation: BAF83527.1
AC079331 Genomic DNA No translation available.
AC110921 Genomic DNA No translation available.
BC007905 mRNA Translation: AAH07905.1
BC067095 mRNA Translation: AAH67095.1
CCDSiCCDS58587.1 [Q9UKF7-2]
CCDS58588.1 [Q9UKF7-1]
RefSeqiNP_036549.2, NM_012417.3 [Q9UKF7-1]
NP_858057.1, NM_181671.2

3D structure databases

SMRiQ9UKF7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117607, 4 interactors
IntActiQ9UKF7, 21 interactors
STRINGi9606.ENSP00000464006

Chemistry databases

SwissLipidsiSLP:000000413
SLP:000000992 [Q9UKF7-1]
SLP:000000993 [Q9UKF7-2]

PTM databases

iPTMnetiQ9UKF7
PhosphoSitePlusiQ9UKF7

Polymorphism and mutation databases

BioMutaiPITPNC1
DMDMi147720965

Proteomic databases

EPDiQ9UKF7
jPOSTiQ9UKF7
MassIVEiQ9UKF7
PaxDbiQ9UKF7
PeptideAtlasiQ9UKF7
PRIDEiQ9UKF7
ProteomicsDBi84783 [Q9UKF7-1]
84784 [Q9UKF7-2]

Genome annotation databases

EnsembliENST00000581322; ENSP00000464006; ENSG00000154217 [Q9UKF7-1]
GeneIDi26207
KEGGihsa:26207
UCSCiuc002jgb.5 human [Q9UKF7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26207
DisGeNETi26207

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PITPNC1
HGNCiHGNC:21045 PITPNC1
HPAiHPA026563
HPA031250
MIMi605134 gene
neXtProtiNX_Q9UKF7
OpenTargetsiENSG00000154217
PharmGKBiPA128394642

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3668 Eukaryota
COG5083 LUCA
GeneTreeiENSGT00940000160720
HOGENOMiHOG000006717
InParanoidiQ9UKF7
OrthoDBi951268at2759

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PITPNC1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26207
PharosiQ9UKF7

Protein Ontology

More...
PROi
PR:Q9UKF7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000154217 Expressed in 212 organ(s), highest expression level in frontal cortex
ExpressionAtlasiQ9UKF7 baseline and differential
GenevisibleiQ9UKF7 HS

Family and domain databases

Gene3Di3.30.530.20, 1 hit
InterProiView protein in InterPro
IPR001666 PI_transfer
IPR023393 START-like_dom_sf
PANTHERiPTHR10658 PTHR10658, 1 hit
PfamiView protein in Pfam
PF02121 IP_trans, 1 hit
PRINTSiPR00391 PITRANSFER

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPITC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UKF7
Secondary accession number(s): A8K473, J3QR20, Q96I07
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: April 16, 2014
Last modified: September 18, 2019
This is version 120 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again