Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Anaphase-promoting complex subunit 7

Gene

ANAPC7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.1 Publication

Caution

It is uncertain whether Met-1 or Met-35 is the initiator.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein phosphatase binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-141430 Inactivation of APC/C via direct inhibition of the APC/C complex
R-HSA-174048 APC/C:Cdc20 mediated degradation of Cyclin B
R-HSA-174084 Autodegradation of Cdh1 by Cdh1:APC/C
R-HSA-174154 APC/C:Cdc20 mediated degradation of Securin
R-HSA-174178 APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-174184 Cdc20:Phospho-APC/C mediated degradation of Cyclin A
R-HSA-176407 Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
R-HSA-176408 Regulation of APC/C activators between G1/S and early anaphase
R-HSA-176409 APC/C:Cdc20 mediated degradation of mitotic proteins
R-HSA-176412 Phosphorylation of the APC/C
R-HSA-179409 APC-Cdc20 mediated degradation of Nek2A
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2559582 Senescence-Associated Secretory Phenotype (SASP)
R-HSA-69017 CDK-mediated phosphorylation and removal of Cdc6
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UJX3

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Anaphase-promoting complex subunit 7
Short name:
APC7
Alternative name(s):
Cyclosome subunit 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANAPC7
Synonyms:APC7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000196510.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17380 ANAPC7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606949 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UJX3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi56L → R: Loss of homodimerization; when associated with K-60. 1 Publication1
Mutagenesisi60L → K: Loss of homodimerization; when associated with R-56. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
51434

Open Targets

More...
OpenTargetsi
ENSG00000196510

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134901290

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANAPC7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
294862527

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001062611 – 599Anaphase-promoting complex subunit 7Add BLAST599

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei263N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UJX3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UJX3

PeptideAtlas

More...
PeptideAtlasi
Q9UJX3

PRoteomics IDEntifications database

More...
PRIDEi
Q9UJX3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84682
84683 [Q9UJX3-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q9UJX3-2 [Q9UJX3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UJX3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UJX3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196510 Expressed in 206 organ(s), highest expression level in esophagus mucosa

CleanEx database of gene expression profiles

More...
CleanExi
HS_ANAPC7

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UJX3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UJX3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009567

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

V-shaped homodimer. The mammalian APC/C is composed at least of 14 distinct subunits ANAPC1, ANAPC2, CDC27/APC3, ANAPC4, ANAPC5, CDC16/APC6, ANAPC7, CDC23/APC8, ANAPC10, ANAPC11, CDC26/APC12, ANAPC13, ANAPC15 and ANAPC16 that assemble into a complex of at least 19 chains with a combined molecular mass of around 1.2 MDa; APC/C interacts with FZR1 and FBXO5 (PubMed:25043029, PubMed:26083744).3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119538, 79 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9UJX3

Database of interacting proteins

More...
DIPi
DIP-39765N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9UJX3

Protein interaction database and analysis system

More...
IntActi
Q9UJX3, 38 interactors

Molecular INTeraction database

More...
MINTi
Q9UJX3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000394394

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1599
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UJX3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UJX3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UJX3

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati135 – 168TPR 1Add BLAST34
Repeati203 – 236TPR 2Add BLAST34
Repeati237 – 270TPR 3Add BLAST34
Repeati271 – 304TPR 4Add BLAST34
Repeati373 – 406TPR 5Add BLAST34
Repeati407 – 440TPR 6Add BLAST34
Repeati441 – 475TPR 7Add BLAST35
Repeati476 – 508TPR 8Add BLAST33
Repeati509 – 542TPR 9Add BLAST34
Repeati543 – 565TPR 10Add BLAST23

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the APC7 family.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1174 Eukaryota
ENOG410XS2B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153625

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007393

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050529

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UJX3

KEGG Orthology (KO)

More...
KOi
K03354

Identification of Orthologs from Complete Genome Data

More...
OMAi
CYEGLID

Database of Orthologous Groups

More...
OrthoDBi
EOG091G07W7

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UJX3

TreeFam database of animal gene trees

More...
TreeFami
TF105445

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13181 TPR_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00028 TPR, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452 SSF48452, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50005 TPR, 5 hits
PS50293 TPR_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UJX3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDPGDAAILE SSLRILYRLF ESVLPPLPAA LQSRMNVIDH VRDMAAAGLH
60 70 80 90 100
SNVRLLSSLL LTMSNNNPEL FSPPQKYQLL VYHADSLFHD KEYRNAVSKY
110 120 130 140 150
TMALQQKKAL SKTSKVRPST GNSASTPQSQ CLPSEIEVKY KMAECYTMLK
160 170 180 190 200
QDKDAIAILD GIPSRQRTPK INMMLANLYK KAGQERPSVT SYKEVLRQCP
210 220 230 240 250
LALDAILGLL SLSVKGAEVA SMTMNVIQTV PNLDWLSVWI KAYAFVHTGD
260 270 280 290 300
NSRAISTICS LEKKSLLRDN VDLLGSLADL YFRAGDNKNS VLKFEQAQML
310 320 330 340 350
DPYLIKGMDV YGYLLAREGR LEDVENLGCR LFNISDQHAE PWVVSGCHSF
360 370 380 390 400
YSKRYSRALY LGAKAIQLNS NSVQALLLKG AALRNMGRVQ EAIIHFREAI
410 420 430 440 450
RLAPCRLDCY EGLIECYLAS NSIREAMVMA NNVYKTLGAN AQTLTLLATV
460 470 480 490 500
CLEDPVTQEK AKTLLDKALT QRPDYIKAVV KKAELLSREQ KYEDGIALLR
510 520 530 540 550
NALANQSDCV LHRILGDFLV AVNEYQEAMD QYSIALSLDP NDQKSLEGMQ
560 570 580 590
KMEKEESPTD ATQEEDVDDM EGSGEEGDLE GSDSEAAQWA DQEQWFGMQ
Length:599
Mass (Da):66,855
Last modified:April 20, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD187A1D9DA41DE2C
GO
Isoform 2 (identifier: Q9UJX3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     537-599: SLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ → R

Show »
Length:537
Mass (Da):60,002
Checksum:i2F7914F35CCFC4A5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YIW2H0YIW2_HUMAN
Anaphase-promoting complex subunit ...
ANAPC7
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIX7H0YIX7_HUMAN
Anaphase-promoting complex subunit ...
ANAPC7
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH17316 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti184Q → R in AAF05754 (PubMed:9469815).Curated1
Sequence conflicti302P → L in AAF05754 (PubMed:9469815).Curated1
Sequence conflicti537S → R in CAB70828 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039043537 – 599SLDPN…WFGMQ → R in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF191340 mRNA Translation: AAF05754.1
BC002941 mRNA Translation: AAH02941.2
BC009498 mRNA Translation: AAH09498.2
BC017316 mRNA Translation: AAH17316.2 Sequence problems.
AL137586 mRNA Translation: CAB70828.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44971.1 [Q9UJX3-2]
CCDS9145.2 [Q9UJX3-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46297

NCBI Reference Sequences

More...
RefSeqi
NP_001131136.1, NM_001137664.1 [Q9UJX3-2]
NP_057322.2, NM_016238.2 [Q9UJX3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.719935

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000450008; ENSP00000402314; ENSG00000196510 [Q9UJX3-2]
ENST00000455511; ENSP00000394394; ENSG00000196510 [Q9UJX3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51434

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51434

UCSC genome browser

More...
UCSCi
uc001tqo.2 human [Q9UJX3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF191340 mRNA Translation: AAF05754.1
BC002941 mRNA Translation: AAH02941.2
BC009498 mRNA Translation: AAH09498.2
BC017316 mRNA Translation: AAH17316.2 Sequence problems.
AL137586 mRNA Translation: CAB70828.1
CCDSiCCDS44971.1 [Q9UJX3-2]
CCDS9145.2 [Q9UJX3-1]
PIRiT46297
RefSeqiNP_001131136.1, NM_001137664.1 [Q9UJX3-2]
NP_057322.2, NM_016238.2 [Q9UJX3-1]
UniGeneiHs.719935

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FFLX-ray2.50A/B/C/D35-181[»]
4UI9electron microscopy3.60X/Y35-599[»]
5A31electron microscopy4.30X/Y1-599[»]
5G04electron microscopy4.00X/Y1-599[»]
5G05electron microscopy3.40X/Y1-599[»]
5KHRelectron microscopy6.10X/Y35-599[»]
5KHUelectron microscopy4.80X/Y35-599[»]
5L9Telectron microscopy6.40X/Y35-599[»]
5L9Uelectron microscopy6.40X/Y35-599[»]
5LCWelectron microscopy4.00X/Y1-599[»]
ProteinModelPortaliQ9UJX3
SMRiQ9UJX3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119538, 79 interactors
CORUMiQ9UJX3
DIPiDIP-39765N
ELMiQ9UJX3
IntActiQ9UJX3, 38 interactors
MINTiQ9UJX3
STRINGi9606.ENSP00000394394

PTM databases

iPTMnetiQ9UJX3
PhosphoSitePlusiQ9UJX3

Polymorphism and mutation databases

BioMutaiANAPC7
DMDMi294862527

Proteomic databases

EPDiQ9UJX3
PaxDbiQ9UJX3
PeptideAtlasiQ9UJX3
PRIDEiQ9UJX3
ProteomicsDBi84682
84683 [Q9UJX3-2]
TopDownProteomicsiQ9UJX3-2 [Q9UJX3-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000450008; ENSP00000402314; ENSG00000196510 [Q9UJX3-2]
ENST00000455511; ENSP00000394394; ENSG00000196510 [Q9UJX3-1]
GeneIDi51434
KEGGihsa:51434
UCSCiuc001tqo.2 human [Q9UJX3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51434
DisGeNETi51434
EuPathDBiHostDB:ENSG00000196510.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANAPC7
HGNCiHGNC:17380 ANAPC7
HPAiCAB009567
MIMi606949 gene
neXtProtiNX_Q9UJX3
OpenTargetsiENSG00000196510
PharmGKBiPA134901290

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1174 Eukaryota
ENOG410XS2B LUCA
GeneTreeiENSGT00940000153625
HOGENOMiHOG000007393
HOVERGENiHBG050529
InParanoidiQ9UJX3
KOiK03354
OMAiCYEGLID
OrthoDBiEOG091G07W7
PhylomeDBiQ9UJX3
TreeFamiTF105445

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-141430 Inactivation of APC/C via direct inhibition of the APC/C complex
R-HSA-174048 APC/C:Cdc20 mediated degradation of Cyclin B
R-HSA-174084 Autodegradation of Cdh1 by Cdh1:APC/C
R-HSA-174154 APC/C:Cdc20 mediated degradation of Securin
R-HSA-174178 APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-174184 Cdc20:Phospho-APC/C mediated degradation of Cyclin A
R-HSA-176407 Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
R-HSA-176408 Regulation of APC/C activators between G1/S and early anaphase
R-HSA-176409 APC/C:Cdc20 mediated degradation of mitotic proteins
R-HSA-176412 Phosphorylation of the APC/C
R-HSA-179409 APC-Cdc20 mediated degradation of Nek2A
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2559582 Senescence-Associated Secretory Phenotype (SASP)
R-HSA-69017 CDK-mediated phosphorylation and removal of Cdc6
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ9UJX3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANAPC7 human
EvolutionaryTraceiQ9UJX3

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ANAPC7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51434

Protein Ontology

More...
PROi
PR:Q9UJX3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196510 Expressed in 206 organ(s), highest expression level in esophagus mucosa
CleanExiHS_ANAPC7
ExpressionAtlasiQ9UJX3 baseline and differential
GenevisibleiQ9UJX3 HS

Family and domain databases

Gene3Di1.25.40.10, 3 hits
InterProiView protein in InterPro
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00028 TPR, 5 hits
SUPFAMiSSF48452 SSF48452, 2 hits
PROSITEiView protein in PROSITE
PS50005 TPR, 5 hits
PS50293 TPR_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAPC7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UJX3
Secondary accession number(s): Q96AC4
, Q96GF4, Q9BU24, Q9NT16
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: April 20, 2010
Last modified: December 5, 2018
This is version 176 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again