Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Purine-rich element-binding protein gamma

Gene

PURG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi51 – 293By similarityAdd BLAST243

GO - Molecular functioni

Keywordsi

Molecular functionDNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Purine-rich element-binding protein gamma
Short name:
Purine-rich element-binding protein G
Gene namesi
Name:PURG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000172733.11
HGNCiHGNC:17930 PURG
MIMi618041 gene
neXtProtiNX_Q9UJV8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000172733
PharmGKBiPA134879671

Polymorphism and mutation databases

BioMutaiPURG
DMDMi74720969

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002559521 – 347Purine-rich element-binding protein gammaAdd BLAST347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei160PhosphoserineBy similarity1
Modified residuei163PhosphoserineBy similarity1
Modified residuei339PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9UJV8
PeptideAtlasiQ9UJV8
PRIDEiQ9UJV8
ProteomicsDBi84664
84665 [Q9UJV8-2]

PTM databases

iPTMnetiQ9UJV8
PhosphoSitePlusiQ9UJV8

Expressioni

Tissue specificityi

Isoform 1 is expressed in testis and glioblastoma. Isoform 2 is expressed in fetal lung.1 Publication

Gene expression databases

BgeeiENSG00000172733 Expressed in 124 organ(s), highest expression level in forebrain
CleanExiHS_PURG
ExpressionAtlasiQ9UJV8 baseline and differential
GenevisibleiQ9UJV8 HS

Organism-specific databases

HPAiHPA047746

Interactioni

Protein-protein interaction databases

BioGridi118979, 2 interactors

Structurei

3D structure databases

ProteinModelPortaliQ9UJV8
SMRiQ9UJV8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi8 – 17Poly-Gly10

Sequence similaritiesi

Belongs to the PUR DNA-binding protein family.Curated

Phylogenomic databases

eggNOGiKOG3074 Eukaryota
ENOG410ZKKR LUCA
GeneTreeiENSGT00390000015406
HOGENOMiHOG000232132
HOVERGENiHBG006888
InParanoidiQ9UJV8
KOiK21800
OMAiIGYFGHT
OrthoDBiEOG091G0JS7
PhylomeDBiQ9UJV8
TreeFamiTF313701

Family and domain databases

InterProiView protein in InterPro
IPR006628 PUR-bd_fam
IPR030501 PURgamma
PANTHERiPTHR12611 PTHR12611, 1 hit
PTHR12611:SF3 PTHR12611:SF3, 1 hit
PfamiView protein in Pfam
PF04845 PurA, 1 hit
SMARTiView protein in SMART
SM00712 PUR, 3 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UJV8-1) [UniParc]FASTAAdd to basket
Also known as: PURG-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERARRRGGG GGRGRGGKNV GGSGLSKSRL YPQAQHSHYP HYAASATPNQ
60 70 80 90 100
AGGAAEIQEL ASKRVDIQKK RFYLDVKQSS RGRFLKIAEV WIGRGRQDNI
110 120 130 140 150
RKSKLTLSLS VAAELKDCLG DFIEHYAHLG LKGHRQEHGH SKEQGSRRRQ
160 170 180 190 200
KHSAPSPPVS VGSEEHPHSV LKTDYIERDN RKYYLDLKEN QRGRFLRIRQ
210 220 230 240 250
TMMRGTGMIG YFGHSLGQEQ TIVLPAQGMI EFRDALVQLI EDYGEGDIEE
260 270 280 290 300
RRGGDDDPLE LPEGTSFRVD NKRFYFDVGS NKYGIFLKVS EVRPPYRNTI
310 320 330 340
TVPFKAWTRF GENFIKYEEE MRKICNSHKE KRMDGRKASG EEQECLD
Length:347
Mass (Da):39,556
Last modified:May 1, 2000 - v1
Checksum:i6134333196DAAFC3
GO
Isoform 2 (identifier: Q9UJV8-2) [UniParc]FASTAAdd to basket
Also known as: PURG-B

The sequence of this isoform differs from the canonical sequence as follows:
     289-347: VSEVRPPYRN...ASGEEQECLD → LTNYPKSRENINLFHCCQIKHKEQPHDTTKTVEE

Show »
Length:322
Mass (Da):36,572
Checksum:iA5601DB3B3C30827
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ENC1K7ENC1_HUMAN
Purine-rich element-binding protein...
PURG
163Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05361326S → G. Corresponds to variant dbSNP:rs11574153Ensembl.1
Natural variantiVAR_053614143E → K. Corresponds to variant dbSNP:rs7464560Ensembl.1
Natural variantiVAR_053615241E → A. Corresponds to variant dbSNP:rs11574151Ensembl.1
Natural variantiVAR_036317316K → T in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021319289 – 347VSEVR…QECLD → LTNYPKSRENINLFHCCQIK HKEQPHDTTKTVEE in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF195513 mRNA Translation: AAF03900.1
AY077841 mRNA Translation: AAL77218.1
BC106708 mRNA Translation: AAI06709.1
CCDSiCCDS34878.1 [Q9UJV8-2]
CCDS6081.1 [Q9UJV8-1]
RefSeqiNP_001015508.1, NM_001015508.2 [Q9UJV8-2]
NP_001310240.1, NM_001323311.1 [Q9UJV8-1]
NP_001310241.1, NM_001323312.1 [Q9UJV8-2]
NP_037489.1, NM_013357.2 [Q9UJV8-1]
UniGeneiHs.373778

Genome annotation databases

EnsembliENST00000339382; ENSP00000345168; ENSG00000172733 [Q9UJV8-2]
ENST00000475541; ENSP00000418721; ENSG00000172733 [Q9UJV8-1]
GeneIDi29942
KEGGihsa:29942
UCSCiuc003xim.2 human [Q9UJV8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF195513 mRNA Translation: AAF03900.1
AY077841 mRNA Translation: AAL77218.1
BC106708 mRNA Translation: AAI06709.1
CCDSiCCDS34878.1 [Q9UJV8-2]
CCDS6081.1 [Q9UJV8-1]
RefSeqiNP_001015508.1, NM_001015508.2 [Q9UJV8-2]
NP_001310240.1, NM_001323311.1 [Q9UJV8-1]
NP_001310241.1, NM_001323312.1 [Q9UJV8-2]
NP_037489.1, NM_013357.2 [Q9UJV8-1]
UniGeneiHs.373778

3D structure databases

ProteinModelPortaliQ9UJV8
SMRiQ9UJV8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118979, 2 interactors

PTM databases

iPTMnetiQ9UJV8
PhosphoSitePlusiQ9UJV8

Polymorphism and mutation databases

BioMutaiPURG
DMDMi74720969

Proteomic databases

PaxDbiQ9UJV8
PeptideAtlasiQ9UJV8
PRIDEiQ9UJV8
ProteomicsDBi84664
84665 [Q9UJV8-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339382; ENSP00000345168; ENSG00000172733 [Q9UJV8-2]
ENST00000475541; ENSP00000418721; ENSG00000172733 [Q9UJV8-1]
GeneIDi29942
KEGGihsa:29942
UCSCiuc003xim.2 human [Q9UJV8-1]

Organism-specific databases

CTDi29942
EuPathDBiHostDB:ENSG00000172733.11
GeneCardsiPURG
HGNCiHGNC:17930 PURG
HPAiHPA047746
MIMi618041 gene
neXtProtiNX_Q9UJV8
OpenTargetsiENSG00000172733
PharmGKBiPA134879671
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3074 Eukaryota
ENOG410ZKKR LUCA
GeneTreeiENSGT00390000015406
HOGENOMiHOG000232132
HOVERGENiHBG006888
InParanoidiQ9UJV8
KOiK21800
OMAiIGYFGHT
OrthoDBiEOG091G0JS7
PhylomeDBiQ9UJV8
TreeFamiTF313701

Miscellaneous databases

ChiTaRSiPURG human
GenomeRNAii29942
PROiPR:Q9UJV8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172733 Expressed in 124 organ(s), highest expression level in forebrain
CleanExiHS_PURG
ExpressionAtlasiQ9UJV8 baseline and differential
GenevisibleiQ9UJV8 HS

Family and domain databases

InterProiView protein in InterPro
IPR006628 PUR-bd_fam
IPR030501 PURgamma
PANTHERiPTHR12611 PTHR12611, 1 hit
PTHR12611:SF3 PTHR12611:SF3, 1 hit
PfamiView protein in Pfam
PF04845 PurA, 1 hit
SMARTiView protein in SMART
SM00712 PUR, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiPURG_HUMAN
AccessioniPrimary (citable) accession number: Q9UJV8
Secondary accession number(s): Q8TE64
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: May 1, 2000
Last modified: October 10, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again