Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (17 Jun 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Purine-rich element-binding protein gamma

Gene

PURG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi51 – 293By similarityAdd BLAST243

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Purine-rich element-binding protein gamma
Short name:
Purine-rich element-binding protein G
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PURG
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172733.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17930 PURG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618041 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UJV8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
29942

Open Targets

More...
OpenTargetsi
ENSG00000172733

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134879671

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UJV8 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PURG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74720969

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002559521 – 347Purine-rich element-binding protein gammaAdd BLAST347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei160PhosphoserineBy similarity1
Modified residuei163PhosphoserineBy similarity1
Modified residuei339PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UJV8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UJV8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UJV8

PeptideAtlas

More...
PeptideAtlasi
Q9UJV8

PRoteomics IDEntifications database

More...
PRIDEi
Q9UJV8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
84664 [Q9UJV8-1]
84665 [Q9UJV8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UJV8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UJV8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in testis and glioblastoma. Isoform 2 is expressed in fetal lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172733 Expressed in forebrain and 123 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UJV8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UJV8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000172733 Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
118979, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000418721

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UJV8 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UJV8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi8 – 17Poly-Gly10

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PUR DNA-binding protein family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3074 Eukaryota
ENOG410ZKKR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183162

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_057873_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UJV8

KEGG Orthology (KO)

More...
KOi
K21800

Identification of Orthologs from Complete Genome Data

More...
OMAi
GSCMEIQ

Database of Orthologous Groups

More...
OrthoDBi
1248813at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UJV8

TreeFam database of animal gene trees

More...
TreeFami
TF313701

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006628 PUR-bd_fam
IPR030501 PURgamma

The PANTHER Classification System

More...
PANTHERi
PTHR12611 PTHR12611, 1 hit
PTHR12611:SF3 PTHR12611:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04845 PurA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00712 PUR, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UJV8-1) [UniParc]FASTAAdd to basket
Also known as: PURG-A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERARRRGGG GGRGRGGKNV GGSGLSKSRL YPQAQHSHYP HYAASATPNQ
60 70 80 90 100
AGGAAEIQEL ASKRVDIQKK RFYLDVKQSS RGRFLKIAEV WIGRGRQDNI
110 120 130 140 150
RKSKLTLSLS VAAELKDCLG DFIEHYAHLG LKGHRQEHGH SKEQGSRRRQ
160 170 180 190 200
KHSAPSPPVS VGSEEHPHSV LKTDYIERDN RKYYLDLKEN QRGRFLRIRQ
210 220 230 240 250
TMMRGTGMIG YFGHSLGQEQ TIVLPAQGMI EFRDALVQLI EDYGEGDIEE
260 270 280 290 300
RRGGDDDPLE LPEGTSFRVD NKRFYFDVGS NKYGIFLKVS EVRPPYRNTI
310 320 330 340
TVPFKAWTRF GENFIKYEEE MRKICNSHKE KRMDGRKASG EEQECLD
Length:347
Mass (Da):39,556
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6134333196DAAFC3
GO
Isoform 2 (identifier: Q9UJV8-2) [UniParc]FASTAAdd to basket
Also known as: PURG-B

The sequence of this isoform differs from the canonical sequence as follows:
     289-347: VSEVRPPYRN...ASGEEQECLD → LTNYPKSRENINLFHCCQIKHKEQPHDTTKTVEE

Show »
Length:322
Mass (Da):36,572
Checksum:iA5601DB3B3C30827
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ENC1K7ENC1_HUMAN
Purine-rich element-binding protein...
PURG
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05361326S → G. Corresponds to variant dbSNP:rs11574153Ensembl.1
Natural variantiVAR_053614143E → K. Corresponds to variant dbSNP:rs7464560Ensembl.1
Natural variantiVAR_053615241E → A. Corresponds to variant dbSNP:rs11574151Ensembl.1
Natural variantiVAR_036317316K → T in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_021319289 – 347VSEVR…QECLD → LTNYPKSRENINLFHCCQIK HKEQPHDTTKTVEE in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF195513 mRNA Translation: AAF03900.1
AY077841 mRNA Translation: AAL77218.1
BC106708 mRNA Translation: AAI06709.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34878.1 [Q9UJV8-2]
CCDS6081.1 [Q9UJV8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001015508.1, NM_001015508.2 [Q9UJV8-2]
NP_001310240.1, NM_001323311.1 [Q9UJV8-1]
NP_001310241.1, NM_001323312.1 [Q9UJV8-2]
NP_037489.1, NM_013357.2 [Q9UJV8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339382; ENSP00000345168; ENSG00000172733 [Q9UJV8-2]
ENST00000475541; ENSP00000418721; ENSG00000172733 [Q9UJV8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29942

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29942

UCSC genome browser

More...
UCSCi
uc003xim.2 human [Q9UJV8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF195513 mRNA Translation: AAF03900.1
AY077841 mRNA Translation: AAL77218.1
BC106708 mRNA Translation: AAI06709.1
CCDSiCCDS34878.1 [Q9UJV8-2]
CCDS6081.1 [Q9UJV8-1]
RefSeqiNP_001015508.1, NM_001015508.2 [Q9UJV8-2]
NP_001310240.1, NM_001323311.1 [Q9UJV8-1]
NP_001310241.1, NM_001323312.1 [Q9UJV8-2]
NP_037489.1, NM_013357.2 [Q9UJV8-1]

3D structure databases

SMRiQ9UJV8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi118979, 2 interactors
STRINGi9606.ENSP00000418721

PTM databases

iPTMnetiQ9UJV8
PhosphoSitePlusiQ9UJV8

Polymorphism and mutation databases

BioMutaiPURG
DMDMi74720969

Proteomic databases

jPOSTiQ9UJV8
MassIVEiQ9UJV8
PaxDbiQ9UJV8
PeptideAtlasiQ9UJV8
PRIDEiQ9UJV8
ProteomicsDBi84664 [Q9UJV8-1]
84665 [Q9UJV8-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23258 90 antibodies

Genome annotation databases

EnsembliENST00000339382; ENSP00000345168; ENSG00000172733 [Q9UJV8-2]
ENST00000475541; ENSP00000418721; ENSG00000172733 [Q9UJV8-1]
GeneIDi29942
KEGGihsa:29942
UCSCiuc003xim.2 human [Q9UJV8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29942
DisGeNETi29942
EuPathDBiHostDB:ENSG00000172733.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PURG
HGNCiHGNC:17930 PURG
HPAiENSG00000172733 Tissue enhanced (brain)
MIMi618041 gene
neXtProtiNX_Q9UJV8
OpenTargetsiENSG00000172733
PharmGKBiPA134879671

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3074 Eukaryota
ENOG410ZKKR LUCA
GeneTreeiENSGT00950000183162
HOGENOMiCLU_057873_1_1_1
InParanoidiQ9UJV8
KOiK21800
OMAiGSCMEIQ
OrthoDBi1248813at2759
PhylomeDBiQ9UJV8
TreeFamiTF313701

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
29942 0 hits in 790 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PURG human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29942
PharosiQ9UJV8 Tbio

Protein Ontology

More...
PROi
PR:Q9UJV8
RNActiQ9UJV8 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172733 Expressed in forebrain and 123 other tissues
ExpressionAtlasiQ9UJV8 baseline and differential
GenevisibleiQ9UJV8 HS

Family and domain databases

InterProiView protein in InterPro
IPR006628 PUR-bd_fam
IPR030501 PURgamma
PANTHERiPTHR12611 PTHR12611, 1 hit
PTHR12611:SF3 PTHR12611:SF3, 1 hit
PfamiView protein in Pfam
PF04845 PurA, 1 hit
SMARTiView protein in SMART
SM00712 PUR, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPURG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UJV8
Secondary accession number(s): Q8TE64
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: May 1, 2000
Last modified: June 17, 2020
This is version 132 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again