Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 187 (31 Jul 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Lymphoid enhancer-binding factor 1

Gene

LEF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Participates in the Wnt signaling pathway. Activates transcription of target genes in the presence of CTNNB1 and EP300. May play a role in hair cell differentiation and follicle morphogenesis. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Regulates T-cell receptor alpha enhancer function. Binds DNA in a sequence-specific manner. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 (By similarity). Isoform 3 lacks the CTNNB1 interaction domain and may be an antagonist for Wnt signaling. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi299 – 367HMG boxPROSITE-ProRule annotationAdd BLAST69

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4086398 Ca2+ pathway
R-HSA-4411364 Binding of TCF/LEF:CTNNB1 to target gene promoters
R-HSA-4641265 Repression of WNT target genes
R-HSA-8951430 RUNX3 regulates WNT signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9UJU2

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UJU2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lymphoid enhancer-binding factor 1
Short name:
LEF-1
Alternative name(s):
T cell-specific transcription factor 1-alpha
Short name:
TCF1-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LEF1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6551 LEF1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
153245 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UJU2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi155T → A: Reduced phosphorylation by NLK; when associated with A-166. 1 Publication1
Mutagenesisi166S → A: Reduced phosphorylation by NLK; when associated with A-155. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
51176

Open Targets

More...
OpenTargetsi
ENSG00000138795

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30331

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3217392

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LEF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
8928194

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000485951 – 399Lymphoid enhancer-binding factor 1Add BLAST399

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki27Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei132PhosphoserineCombined sources1
Modified residuei155Phosphothreonine; by NLK1 Publication1
Modified residuei166Phosphoserine; by NLK1 Publication1
Cross-linki269Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Thr-155 and/or Ser-166 by NLK. Phosphorylation by NLK at these sites represses LEF1-mediated transcriptional activation of target genes of the canonical Wnt signaling pathway.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UJU2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UJU2

PeptideAtlas

More...
PeptideAtlasi
Q9UJU2

PRoteomics IDEntifications database

More...
PRIDEi
Q9UJU2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
19686
84650 [Q9UJU2-1]
84651 [Q9UJU2-2]
84652 [Q9UJU2-3]
84653 [Q9UJU2-4]
84654 [Q9UJU2-5]
84655 [Q9UJU2-6]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q9UJU2-2 [Q9UJU2-2]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2055

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UJU2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UJU2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in thymus. Not detected in normal colon, but highly expressed in colon cancer biopsies and colon cancer cell lines. Expressed in several pancreatic tumors and weakly expressed in normal pancreatic tissue. Isoforms 1 and 5 are detected in several pancreatic cell lines.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138795 Expressed in 202 organ(s), highest expression level in female gonad

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UJU2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UJU2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB019405
HPA002087

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds the armadillo repeat of CTNNB1 and forms a stable complex.

Interacts with EP300, TLE1 and PIASG (By similarity). Binds ALYREF/THOC4, MDFI and MDFIC.

Interacts with NLK.

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119354, 43 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-316 beta1-catenin - LEF1 complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9UJU2

Database of interacting proteins

More...
DIPi
DIP-29946N

Protein interaction database and analysis system

More...
IntActi
Q9UJU2, 23 interactors

Molecular INTeraction database

More...
MINTi
Q9UJU2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000265165

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UJU2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 62CTNNB1-bindingBy similarityAdd BLAST62

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi6 – 13Poly-Gly8
Compositional biasi14 – 52Asp/Glu-rich (acidic)Add BLAST39
Compositional biasi77 – 273Pro-richAdd BLAST197
Compositional biasi374 – 379Poly-Lys6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Proline-rich and acidic regions are implicated in the activation functions of RNA polymerase II transcription factors.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TCF/LEF family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3248 Eukaryota
ENOG41109RU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159660

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000116032

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UJU2

KEGG Orthology (KO)

More...
KOi
K04492

Identification of Orthologs from Complete Genome Data

More...
OMAi
GYSGYIM

Database of Orthologous Groups

More...
OrthoDBi
807716at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UJU2

TreeFam database of animal gene trees

More...
TreeFami
TF318448

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.30.10, 1 hit
4.10.900.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027397 Catenin_binding_dom_sf
IPR013558 CTNNB1-bd_N
IPR009071 HMG_box_dom
IPR036910 HMG_box_dom_sf
IPR028769 LEF1
IPR024940 TCF/LEF

The PANTHER Classification System

More...
PANTHERi
PTHR10373 PTHR10373, 1 hit
PTHR10373:SF11 PTHR10373:SF11, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08347 CTNNB1_binding, 1 hit
PF00505 HMG_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00398 HMG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47095 SSF47095, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50118 HMG_BOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UJU2-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPQLSGGGGG GGGDPELCAT DEMIPFKDEG DPQKEKIFAE ISHPEEEGDL
60 70 80 90 100
ADIKSSLVNE SEIIPASNGH EVARQAQTSQ EPYHDKAREH PDDGKHPDGG
110 120 130 140 150
LYNKGPSYSS YSGYIMMPNM NNDPYMSNGS LSPPIPRTSN KVPVVQPSHA
160 170 180 190 200
VHPLTPLITY SDEHFSPGSH PSHIPSDVNS KQGMSRHPPA PDIPTFYPLS
210 220 230 240 250
PGGVGQITPP LGWQGQPVYP ITGGFRQPYP SSLSVDTSMS RFSHHMIPGP
260 270 280 290 300
PGPHTTGIPH PAIVTPQVKQ EHPHTDSDLM HVKPQHEQRK EQEPKRPHIK
310 320 330 340 350
KPLNAFMLYM KEMRANVVAE CTLKESAAIN QILGRRWHAL SREEQAKYYE
360 370 380 390
LARKERQLHM QLYPGWSARD NYGKKKKRKR EKLQESASGT GPRMTAAYI
Note: Produced by alternative promoter usage.
Length:399
Mass (Da):44,201
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD480D440698EEFE3
GO
Isoform 2 (identifier: Q9UJU2-2) [UniParc]FASTAAdd to basket
Also known as: B, 8A

The sequence of this isoform differs from the canonical sequence as follows:
     283-399: KPQHEQRKEQ...TGPRMTAAYI → CSAFLLPHPF...SQKDLTLRSL

Note: Produced by alternative splicing of isoform 1. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:329
Mass (Da):35,672
Checksum:i3632325D440CA5DD
GO
Isoform 3 (identifier: Q9UJU2-3) [UniParc]FASTAAdd to basket
Also known as: LEF-1-DN

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.

Note: Produced by alternative promoter usage. Acts as dominant negative mutant.
Show »
Length:284
Mass (Da):31,919
Checksum:i22320A1A195401ED
GO
Isoform 4 (identifier: Q9UJU2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.
     283-399: KPQHEQRKEQ...TGPRMTAAYI → CSAFLLPHPF...SQKDLTLRSL

Note: Produced by alternative splicing of isoform 3.
Show »
Length:214
Mass (Da):23,390
Checksum:iDDBF9358A5E8944C
GO
Isoform 5 (identifier: Q9UJU2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-241: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:371
Mass (Da):41,162
Checksum:iF929C8679F4EC1A3
GO
Isoform 6 (identifier: Q9UJU2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-241: Missing.
     390-399: TGPRMTAAYI → GKRSSFPTCKAKAATPGPLLEMEAC

Note: Produced by alternative splicing of isoform 1. No experimental confirmation available.
Show »
Length:386
Mass (Da):42,676
Checksum:i918B4201D718A485
GO
Isoform 7 (identifier: Q9UJU2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGH → MA
     214-241: Missing.

Note: No experimental confirmation available.
Show »
Length:303
Mass (Da):34,103
Checksum:i38F7331074A62A79
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RIV1D6RIV1_HUMAN
Lymphoid enhancer-binding factor 1
LEF1
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAB1D6RAB1_HUMAN
Lymphoid enhancer-binding factor 1
LEF1
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RID7D6RID7_HUMAN
Lymphoid enhancer-binding factor 1
LEF1
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti146Q → R in BAH13928 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035935113G → R in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs369649181Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0070221 – 115Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_0448771 – 70MPQLS…ASNGH → MA in isoform 7. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_040068214 – 241Missing in isoform 5, isoform 6 and isoform 7. 3 PublicationsAdd BLAST28
Alternative sequenceiVSP_002188283 – 399KPQHE…TAAYI → CSAFLLPHPFLIPSTPSPNH HHHHLLGSLSMNRERSRSQK DLTLRSL in isoform 2 and isoform 4. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_040069390 – 399TGPRMTAAYI → GKRSSFPTCKAKAATPGPLL EMEAC in isoform 6. 1 Publication10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF288571 mRNA Translation: AAG01022.1
AF198532 mRNA Translation: AAF13268.1
AF294627 mRNA Translation: AAG26886.1
AK294395 mRNA Translation: BAG57649.1
AK303272 mRNA Translation: BAH13928.1
AC092539 Genomic DNA No translation available.
AC097067 Genomic DNA No translation available.
AC118062 Genomic DNA No translation available.
AC123576 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06223.1
CH471057 Genomic DNA Translation: EAX06225.1
BC040559 mRNA Translation: AAH40559.1
BC050632 mRNA Translation: AAH50632.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3679.1 [Q9UJU2-1]
CCDS47122.1 [Q9UJU2-6]
CCDS47123.1 [Q9UJU2-5]
CCDS54791.1 [Q9UJU2-7]

Protein sequence database of the Protein Information Resource

More...
PIRi
A39625

NCBI Reference Sequences

More...
RefSeqi
NP_001124185.1, NM_001130713.2 [Q9UJU2-5]
NP_001124186.1, NM_001130714.2 [Q9UJU2-6]
NP_001159591.1, NM_001166119.1 [Q9UJU2-7]
NP_057353.1, NM_016269.4 [Q9UJU2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265165; ENSP00000265165; ENSG00000138795 [Q9UJU2-1]
ENST00000379951; ENSP00000369284; ENSG00000138795 [Q9UJU2-6]
ENST00000438313; ENSP00000406176; ENSG00000138795 [Q9UJU2-5]
ENST00000506680; ENSP00000422334; ENSG00000138795 [Q9UJU2-2]
ENST00000510624; ENSP00000422840; ENSG00000138795 [Q9UJU2-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51176

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51176

UCSC genome browser

More...
UCSCi
uc003hyt.3 human [Q9UJU2-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288571 mRNA Translation: AAG01022.1
AF198532 mRNA Translation: AAF13268.1
AF294627 mRNA Translation: AAG26886.1
AK294395 mRNA Translation: BAG57649.1
AK303272 mRNA Translation: BAH13928.1
AC092539 Genomic DNA No translation available.
AC097067 Genomic DNA No translation available.
AC118062 Genomic DNA No translation available.
AC123576 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06223.1
CH471057 Genomic DNA Translation: EAX06225.1
BC040559 mRNA Translation: AAH40559.1
BC050632 mRNA Translation: AAH50632.1
CCDSiCCDS3679.1 [Q9UJU2-1]
CCDS47122.1 [Q9UJU2-6]
CCDS47123.1 [Q9UJU2-5]
CCDS54791.1 [Q9UJU2-7]
PIRiA39625
RefSeqiNP_001124185.1, NM_001130713.2 [Q9UJU2-5]
NP_001124186.1, NM_001130714.2 [Q9UJU2-6]
NP_001159591.1, NM_001166119.1 [Q9UJU2-7]
NP_057353.1, NM_016269.4 [Q9UJU2-1]

3D structure databases

SMRiQ9UJU2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119354, 43 interactors
ComplexPortaliCPX-316 beta1-catenin - LEF1 complex
CORUMiQ9UJU2
DIPiDIP-29946N
IntActiQ9UJU2, 23 interactors
MINTiQ9UJU2
STRINGi9606.ENSP00000265165

Chemistry databases

ChEMBLiCHEMBL3217392

PTM databases

GlyConnecti2055
iPTMnetiQ9UJU2
PhosphoSitePlusiQ9UJU2

Polymorphism and mutation databases

BioMutaiLEF1
DMDMi8928194

Proteomic databases

jPOSTiQ9UJU2
PaxDbiQ9UJU2
PeptideAtlasiQ9UJU2
PRIDEiQ9UJU2
ProteomicsDBi19686
84650 [Q9UJU2-1]
84651 [Q9UJU2-2]
84652 [Q9UJU2-3]
84653 [Q9UJU2-4]
84654 [Q9UJU2-5]
84655 [Q9UJU2-6]
TopDownProteomicsiQ9UJU2-2 [Q9UJU2-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51176
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265165; ENSP00000265165; ENSG00000138795 [Q9UJU2-1]
ENST00000379951; ENSP00000369284; ENSG00000138795 [Q9UJU2-6]
ENST00000438313; ENSP00000406176; ENSG00000138795 [Q9UJU2-5]
ENST00000506680; ENSP00000422334; ENSG00000138795 [Q9UJU2-2]
ENST00000510624; ENSP00000422840; ENSG00000138795 [Q9UJU2-7]
GeneIDi51176
KEGGihsa:51176
UCSCiuc003hyt.3 human [Q9UJU2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51176
DisGeNETi51176

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LEF1
HGNCiHGNC:6551 LEF1
HPAiCAB019405
HPA002087
MIMi153245 gene
neXtProtiNX_Q9UJU2
OpenTargetsiENSG00000138795
PharmGKBiPA30331

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3248 Eukaryota
ENOG41109RU LUCA
GeneTreeiENSGT00940000159660
HOGENOMiHOG000116032
InParanoidiQ9UJU2
KOiK04492
OMAiGYSGYIM
OrthoDBi807716at2759
PhylomeDBiQ9UJU2
TreeFamiTF318448

Enzyme and pathway databases

ReactomeiR-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4086398 Ca2+ pathway
R-HSA-4411364 Binding of TCF/LEF:CTNNB1 to target gene promoters
R-HSA-4641265 Repression of WNT target genes
R-HSA-8951430 RUNX3 regulates WNT signaling
SignaLinkiQ9UJU2
SIGNORiQ9UJU2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LEF1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Lymphoid_enhancer-binding_factor_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51176

Protein Ontology

More...
PROi
PR:Q9UJU2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138795 Expressed in 202 organ(s), highest expression level in female gonad
ExpressionAtlasiQ9UJU2 baseline and differential
GenevisibleiQ9UJU2 HS

Family and domain databases

Gene3Di1.10.30.10, 1 hit
4.10.900.10, 1 hit
InterProiView protein in InterPro
IPR027397 Catenin_binding_dom_sf
IPR013558 CTNNB1-bd_N
IPR009071 HMG_box_dom
IPR036910 HMG_box_dom_sf
IPR028769 LEF1
IPR024940 TCF/LEF
PANTHERiPTHR10373 PTHR10373, 1 hit
PTHR10373:SF11 PTHR10373:SF11, 1 hit
PfamiView protein in Pfam
PF08347 CTNNB1_binding, 1 hit
PF00505 HMG_box, 1 hit
SMARTiView protein in SMART
SM00398 HMG, 1 hit
SUPFAMiSSF47095 SSF47095, 1 hit
PROSITEiView protein in PROSITE
PS50118 HMG_BOX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLEF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UJU2
Secondary accession number(s): B4DG38
, B7Z8E2, E9PDK3, Q3ZCU4, Q9HAZ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: July 31, 2019
This is version 187 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again