Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (10 Feb 2021)
Sequence version 2 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Tubulin delta chain

Gene

TUBD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a positive regulator of hedgehog signaling and regulates ciliary function.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi143 – 149GTPSequence analysis7

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCilium biogenesis/degradation
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9UJT1

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UJT1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tubulin delta chain
Alternative name(s):
Delta-tubulin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TUBD1
Synonyms:TUBD
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16811, TUBD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607344, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UJT1

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000108423.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51174

Open Targets

More...
OpenTargetsi
ENSG00000108423

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134909953

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UJT1, Tbio

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00570, Vinblastine

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TUBD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
124056483

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000484841 – 453Tubulin delta chainAdd BLAST453

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UJT1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UJT1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UJT1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UJT1

PeptideAtlas

More...
PeptideAtlasi
Q9UJT1

PRoteomics IDEntifications database

More...
PRIDEi
Q9UJT1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19408
19495
5305
84644 [Q9UJT1-1]
84645 [Q9UJT1-2]
84646 [Q9UJT1-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UJT1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UJT1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000108423, Expressed in secondary oocyte and 217 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UJT1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UJT1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000108423, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex with TEDC1, TEDC2, TUBE1 and TUBD1.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
119352, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UJT1, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000320797

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UJT1, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tubulin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1374, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157069

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1371783_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UJT1

Identification of Orthologs from Complete Genome Data

More...
OMAi
ACHPEYK

Database of Orthologous Groups

More...
OrthoDBi
1166669at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UJT1

TreeFam database of animal gene trees

More...
TreeFami
TF329833

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.287.600, 1 hit
3.40.50.1440, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002967, Delta_tubulin
IPR008280, Tub_FtsZ_C
IPR000217, Tubulin
IPR036525, Tubulin/FtsZ_GTPase_sf
IPR023123, Tubulin_C
IPR017975, Tubulin_CS
IPR003008, Tubulin_FtsZ_GTPase

The PANTHER Classification System

More...
PANTHERi
PTHR11588, PTHR11588, 1 hit
PTHR11588:SF4, PTHR11588:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00091, Tubulin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01224, DELTATUBULIN
PR01161, TUBULIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00864, Tubulin, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52490, SSF52490, 1 hit
SSF55307, SSF55307, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00227, TUBULIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UJT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSIVTVQLGQ CGNQIGFEVF DALLSDSHSS QGLCSMRENE AYQASCKERF
60 70 80 90 100
FSEEENGVPI ARAVLVDMEP KVINQMLSKA AQSGQWKYGQ HACFCQKQGS
110 120 130 140 150
GNNWAYGYSV HGPRHEESIM NIIRKEVEKC DSFSGFFIIM SMAGGTGSGL
160 170 180 190 200
GAFVTQNLED QYSNSLKMNQ IIWPYGTGEV IVQNYNSILT LSHLYRSSDA
210 220 230 240 250
LLLHENDAIH KICAKLMNIK QISFSDINQV LAHQLGSVFQ PTYSAESSFH
260 270 280 290 300
YRRNPLGDLM EHLVPHPEFK MLSVRNIPHM SENSLAYTTF TWAGLLKHLR
310 320 330 340 350
QMLISNAKME EGIDRHVWPP LSGLPPLSKM SLNKDLHFNT SIANLVILRG
360 370 380 390 400
KDVQSADVEG FKDPALYTSW LKPVNAFNVW KTQRAFSKYE KSAVLVSNSQ
410 420 430 440 450
FLVKPLDMIV GKAWNMFASK AYIHQYTKFG IEEEDFLDSF TSLEQVVASY

CNL
Length:453
Mass (Da):51,034
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2D78AB3D9EEB9158
GO
Isoform 2 (identifier: Q9UJT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-311: Missing.

Show »
Length:398
Mass (Da):44,658
Checksum:iBEE6B7C9F36B5541
GO
Isoform 3 (identifier: Q9UJT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-311: Missing.

Show »
Length:199
Mass (Da):22,381
Checksum:iECCC2578542A1114
GO
Isoform 4 (identifier: Q9UJT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.

Show »
Length:237
Mass (Da):27,074
Checksum:iD16AE1CDD4E5E1C4
GO
Isoform 5 (identifier: Q9UJT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-420: VEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK → VGKKFR

Show »
Length:396
Mass (Da):44,555
Checksum:iE26BC25E242DC48D
GO
Isoform 6 (identifier: Q9UJT1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-358: Missing.

Show »
Length:351
Mass (Da):39,525
Checksum:i2F6715FAD6D6E9B2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EQN9K7EQN9_HUMAN
Delta-tubulin
TUBD1
125Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKE2K7EKE2_HUMAN
Tubulin delta chain
TUBD1
97Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMW6K7EMW6_HUMAN
Tubulin delta chain
TUBD1
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPQ0K7EPQ0_HUMAN
Tubulin delta chain
TUBD1
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti130C → R in BAG60700 (PubMed:14702039).Curated1
Sequence conflicti270K → R in BAG60700 (PubMed:14702039).Curated1
Sequence conflicti398N → D in BAB14825 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03000076M → T2 PublicationsCorresponds to variant dbSNP:rs1292053Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451961 – 216Missing in isoform 4. 1 PublicationAdd BLAST216
Alternative sequenceiVSP_00668058 – 311Missing in isoform 3. 1 PublicationAdd BLAST254
Alternative sequenceiVSP_046949257 – 358Missing in isoform 6. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_006681257 – 311Missing in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_046950358 – 420VEGFK…MFASK → VGKKFR in isoform 5. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF201333 mRNA Translation: AAF09584.1
AB030837 mRNA Translation: BAD16590.1
AB031045 mRNA Translation: BAD83581.1
AK024096 mRNA Translation: BAB14825.1
AK298492 mRNA Translation: BAG60700.1
AK301312 mRNA Translation: BAG62863.1
AC004686 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94385.1
CH471109 Genomic DNA Translation: EAW94387.1
BC000258 mRNA Translation: AAH00258.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11620.1 [Q9UJT1-1]
CCDS54151.1 [Q9UJT1-4]
CCDS54152.1 [Q9UJT1-6]
CCDS54153.1 [Q9UJT1-2]
CCDS54154.1 [Q9UJT1-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001180538.1, NM_001193609.1 [Q9UJT1-2]
NP_001180539.1, NM_001193610.1 [Q9UJT1-5]
NP_001180540.1, NM_001193611.1 [Q9UJT1-6]
NP_001180541.1, NM_001193612.1
NP_001180542.1, NM_001193613.1 [Q9UJT1-4]
NP_057345.2, NM_016261.3 [Q9UJT1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325752; ENSP00000320797; ENSG00000108423 [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423 [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423 [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423 [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423 [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423 [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423 [Q9UJT1-1]
ENST00000613721; ENSP00000480387; ENSG00000108423 [Q9UJT1-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51174

UCSC genome browser

More...
UCSCi
uc002ixw.3, human [Q9UJT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201333 mRNA Translation: AAF09584.1
AB030837 mRNA Translation: BAD16590.1
AB031045 mRNA Translation: BAD83581.1
AK024096 mRNA Translation: BAB14825.1
AK298492 mRNA Translation: BAG60700.1
AK301312 mRNA Translation: BAG62863.1
AC004686 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94385.1
CH471109 Genomic DNA Translation: EAW94387.1
BC000258 mRNA Translation: AAH00258.1
CCDSiCCDS11620.1 [Q9UJT1-1]
CCDS54151.1 [Q9UJT1-4]
CCDS54152.1 [Q9UJT1-6]
CCDS54153.1 [Q9UJT1-2]
CCDS54154.1 [Q9UJT1-5]
RefSeqiNP_001180538.1, NM_001193609.1 [Q9UJT1-2]
NP_001180539.1, NM_001193610.1 [Q9UJT1-5]
NP_001180540.1, NM_001193611.1 [Q9UJT1-6]
NP_001180541.1, NM_001193612.1
NP_001180542.1, NM_001193613.1 [Q9UJT1-4]
NP_057345.2, NM_016261.3 [Q9UJT1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi119352, 10 interactors
IntActiQ9UJT1, 5 interactors
STRINGi9606.ENSP00000320797

Chemistry databases

DrugBankiDB00570, Vinblastine

PTM databases

iPTMnetiQ9UJT1
PhosphoSitePlusiQ9UJT1

Genetic variation databases

BioMutaiTUBD1
DMDMi124056483

Proteomic databases

EPDiQ9UJT1
jPOSTiQ9UJT1
MassIVEiQ9UJT1
PaxDbiQ9UJT1
PeptideAtlasiQ9UJT1
PRIDEiQ9UJT1
ProteomicsDBi19408
19495
5305
84644 [Q9UJT1-1]
84645 [Q9UJT1-2]
84646 [Q9UJT1-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3899, 127 antibodies

Genome annotation databases

EnsembliENST00000325752; ENSP00000320797; ENSG00000108423 [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423 [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423 [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423 [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423 [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423 [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423 [Q9UJT1-1]
ENST00000613721; ENSP00000480387; ENSG00000108423 [Q9UJT1-6]
GeneIDi51174
KEGGihsa:51174
UCSCiuc002ixw.3, human [Q9UJT1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51174
DisGeNETi51174

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TUBD1
HGNCiHGNC:16811, TUBD1
HPAiENSG00000108423, Low tissue specificity
MIMi607344, gene
neXtProtiNX_Q9UJT1
OpenTargetsiENSG00000108423
PharmGKBiPA134909953
VEuPathDBiHostDB:ENSG00000108423.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1374, Eukaryota
GeneTreeiENSGT00940000157069
HOGENOMiCLU_1371783_0_0_1
InParanoidiQ9UJT1
OMAiACHPEYK
OrthoDBi1166669at2759
PhylomeDBiQ9UJT1
TreeFamiTF329833

Enzyme and pathway databases

PathwayCommonsiQ9UJT1
SIGNORiQ9UJT1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
51174, 182 hits in 881 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TUBD1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TUBD1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51174
PharosiQ9UJT1, Tbio

Protein Ontology

More...
PROi
PR:Q9UJT1
RNActiQ9UJT1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000108423, Expressed in secondary oocyte and 217 other tissues
ExpressionAtlasiQ9UJT1, baseline and differential
GenevisibleiQ9UJT1, HS

Family and domain databases

Gene3Di1.10.287.600, 1 hit
3.40.50.1440, 1 hit
InterProiView protein in InterPro
IPR002967, Delta_tubulin
IPR008280, Tub_FtsZ_C
IPR000217, Tubulin
IPR036525, Tubulin/FtsZ_GTPase_sf
IPR023123, Tubulin_C
IPR017975, Tubulin_CS
IPR003008, Tubulin_FtsZ_GTPase
PANTHERiPTHR11588, PTHR11588, 1 hit
PTHR11588:SF4, PTHR11588:SF4, 1 hit
PfamiView protein in Pfam
PF00091, Tubulin, 1 hit
PRINTSiPR01224, DELTATUBULIN
PR01161, TUBULIN
SMARTiView protein in SMART
SM00864, Tubulin, 1 hit
SUPFAMiSSF52490, SSF52490, 1 hit
SSF55307, SSF55307, 1 hit
PROSITEiView protein in PROSITE
PS00227, TUBULIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTBD_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UJT1
Secondary accession number(s): B4DPT8
, B4DW01, D3DU02, E9PCA7, E9PCQ8, Q5KU36, Q9BWG9, Q9H7Z8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: February 10, 2021
This is version 180 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again