Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UJA3 (MCM8_HUMAN)

Entry version 185 (17 Jun 2020)
Sequence version 2 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DNA helicase MCM8

Gene

MCM8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the MCM8-MCM9 complex, a complex involved in the repair of double-stranded DNA breaks (DBSs) and DNA interstrand cross-links (ICLs) by homologous recombination (HR) (PubMed:23401855). Required for DNA resection by the MRE11-RAD50-NBN/NBS1 (MRN) complex by recruiting the MRN complex to the repair site and by promoting the complex nuclease activity (PubMed:26215093). Probably by regulating the localization of the MNR complex, indirectly regulates the recruitment of downstream effector RAD51 to DNA damage sites including DBSs and ICLs (PubMed:23401855). The MCM8-MCM9 complex is dispensable for DNA replication and S phase progression (PubMed:23401855). However, may play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G1 phase by recruiting CDC6 to the origin recognition complex (ORC) (PubMed:15684404). Probably by regulating HR, plays a key role during gametogenesis (By similarity). Stabilizes MCM9 protein (PubMed:23401855, PubMed:26215093).By similarity3 Publications

Caution

Was initially thought to play a role in DNA replication (PubMed:15684404). However, it was later shown that it is mainly involved in homologous recombination repair (PubMed:23401855).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi454 – 461ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Helicase, Hydrolase
Biological processCell cycle, DNA damage, DNA repair, DNA replication
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-113507 E2F-enabled inhibition of pre-replication complex formation
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-176974 Unwinding of DNA
R-HSA-68689 CDC6 association with the ORC:origin complex
R-HSA-68827 CDT1 association with the CDC6:ORC:origin complex
R-HSA-68867 Assembly of the pre-replicative complex
R-HSA-68949 Orc1 removal from chromatin
R-HSA-68962 Activation of the pre-replicative complex

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA helicase MCM8 (EC:3.6.4.121 Publication)
Alternative name(s):
Minichromosome maintenance 8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MCM8
Synonyms:C20orf154
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000125885.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:16147 MCM8

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608187 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UJA3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Premature ovarian failure 10 (POF10)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_073417149P → R in POF10; inhibits protein recruitment to sites of DNA damage; shows significant reduction in DNA-binding affinity for single-strand DNA. 1 PublicationCorresponds to variant dbSNP:rs606231343EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi456P → A: Decreases the formation of MRE11 and RPA1 foci in response to cisplatin-induced DNA damage. 1 Publication1

Keywords - Diseasei

Disease mutation, Premature ovarian failure

Organism-specific databases

DisGeNET

More...DisGeNETi		84515

MalaCards human disease database

More...MalaCardsi		MCM8
MIMi612885 phenotype

Open Targets

More...OpenTargetsi		ENSG00000125885

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		619 NON RARE IN EUROPE: Primary ovarian failure

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25696

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UJA3 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MCM8

Domain mapping of disease mutations (DMDM)

More...DMDMi		27805609

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001941251 – 840DNA helicase MCM8Add BLAST840

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei630PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UJA3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UJA3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UJA3

PeptideAtlas

More...PeptideAtlasi		Q9UJA3

PRoteomics IDEntifications database

More...PRIDEi		Q9UJA3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		17650
84610 [Q9UJA3-1]
84611 [Q9UJA3-2]
84612 [Q9UJA3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UJA3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UJA3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest levels in placenta, lung and pancreas. Low levels in skeletal muscle and kidney. Expressed in various tumors with highest levels in colon and lung cancers.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By E2F1.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000125885 Expressed in testis and 186 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UJA3 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000125885 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the MCM8-MCM9 complex, which forms a hexamer composed of MCM8 and MCM9 (PubMed:23401855, PubMed:26300262).

Interacts with the DNA mismatch repair (MMR) complex composed at least of MSH2, MSH3, MSH6, PMS1 and MLH1 (PubMed:26300262).

Interacts with RAD51; the interaction recruits RAD51 to DNA damage sites (PubMed:23401855).

Interacts with the MRN complex composed of MRE11, RAD50 and NBN/NBS1 (PubMed:26215093).

Interacts with CDC6 and ORC2 (PubMed:15684404).

Interacts with HROB; the interaction recruits the MCM8-MCM9 complex to DNA damage sites (PubMed:31467087).

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124109, 37 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9UJA3

Protein interaction database and analysis system

More...IntActi		Q9UJA3, 23 interactors

Molecular INTeraction database

More...MINTi		Q9UJA3

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000368164

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UJA3 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini402 – 609MCMAdd BLAST208

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi481 – 490Thr-rich10

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MCM family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0480 Eukaryota
COG1241 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00980000198511

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000995_7_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UJA3

KEGG Orthology (KO)

More...KOi		K10737

Identification of Orthologs from Complete Genome Data

More...OMAi		SNRSQAK

Database of Orthologous Groups

More...OrthoDBi		266497at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UJA3

TreeFam database of animal gene trees

More...TreeFami		TF323155

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003593 AAA+_ATPase
IPR031327 MCM
IPR001208 MCM_dom
IPR041562 MCM_lid
IPR033762 MCM_OB
IPR012340 NA-bd_OB-fold
IPR027417 P-loop_NTPase

The PANTHER Classification System

More...PANTHERi		PTHR11630 PTHR11630, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00493 MCM, 1 hit
PF17855 MCM_lid, 1 hit
PF17207 MCM_OB, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01657 MCMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00382 AAA, 1 hit
SM00350 MCM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50249 SSF50249, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50051 MCM_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9UJA3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGEYRGRGF GRGRFQSWKR GRGGGNFSGK WREREHRPDL SKTTGKRTSE 
        60         70         80         90        100
QTPQFLLSTK TPQSMQSTLD RFIPYKGWKL YFSEVYSDSS PLIEKIQAFE 
       110        120        130        140        150
KFFTRHIDLY DKDEIERKGS ILVDFKELTE GGEVTNLIPD IATELRDAPE 
       160        170        180        190        200
KTLACMGLAI HQVLTKDLER HAAELQAQEG LSNDGETMVN VPHIHARVYN 
       210        220        230        240        250
YEPLTQLKNV RANYYGKYIA LRGTVVRVSN IKPLCTKMAF LCAACGEIQS 
       260        270        280        290        300
FPLPDGKYSL PTKCPVPVCR GRSFTALRSS PLTVTMDWQS IKIQELMSDD 
       310        320        330        340        350
QREAGRIPRT IECELVHDLV DSCVPGDTVT ITGIVKVSNA EEGSRNKNDK 
       360        370        380        390        400
CMFLLYIEAN SISNSKGQKT KSSEDGCKHG MLMEFSLKDL YAIQEIQAEE 
       410        420        430        440        450
NLFKLIVNSL CPVIFGHELV KAGLALALFG GSQKYADDKN RIPIRGDPHI 
       460        470        480        490        500
LVVGDPGLGK SQMLQAACNV APRGVYVCGN TTTTSGLTVT LSKDSSSGDF 
       510        520        530        540        550
ALEAGALVLG DQGICGIDEF DKMGNQHQAL LEAMEQQSIS LAKAGVVCSL 
       560        570        580        590        600
PARTSIIAAA NPVGGHYNKA KTVSENLKMG SALLSRFDLV FILLDTPNEH 
       610        620        630        640        650
HDHLLSEHVI AIRAGKQRTI SSATVARMNS QDSNTSVLEV VSEKPLSERL 
       660        670        680        690        700
KVVPGETIDP IPHQLLRKYI GYARQYVYPR LSTEAARVLQ DFYLELRKQS 
       710        720        730        740        750
QRLNSSPITT RQLESLIRLT EARARLELRE EATKEDAEDI VEIMKYSMLG 
       760        770        780        790        800
TYSDEFGNLD FERSQHGSGM SNRSTAKRFI SALNNVAERT YNNIFQFHQL 
       810        820        830        840
RQIAKELNIQ VADFENFIGS LNDQGYLLKK GPKVYQLQTM
Length:840
Mass (Da):93,697
Last modified:June 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6349339A92FEBF88
GO
Isoform 2 (identifier: Q9UJA3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-465: Missing.

Show »
Length:793
Mass (Da):88,756
Checksum:i39112134BB33E3B4
GO
Isoform 3 (identifier: Q9UJA3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     342-357: Missing.

Note: No experimental confirmation available. According to PubMed:12771218, this isoform could be derived from an aberrant mRNA form found in placental choriocarcinoma.
Show »
Length:824
Mass (Da):91,784
Checksum:i829B4E10F9E00702
GO
Isoform 4 (identifier: Q9UJA3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     408-418: NSLCPVIFGHE → KWSLALSPRLEYSGAISAHCNLHLPSSNSSPTSACRVAGTTGMRHQTQLLL

Show »
Length:880
Mass (Da):97,932
Checksum:iC14BC728273EEED6
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB55260 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti590V → A in AAI01056 (PubMed:15489334).Curated1
Sequence conflicti788E → G in AAI01055 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01514563Q → K. Corresponds to variant dbSNP:rs236110Ensembl.1
Natural variantiVAR_050281101K → N. Corresponds to variant dbSNP:rs6117014Ensembl.1
Natural variantiVAR_073417149P → R in POF10; inhibits protein recruitment to sites of DNA damage; shows significant reduction in DNA-binding affinity for single-strand DNA. 1 PublicationCorresponds to variant dbSNP:rs606231343EnsemblClinVar.1
Natural variantiVAR_050282183N → S. Corresponds to variant dbSNP:rs16991591Ensembl.1
Natural variantiVAR_050283341E → K Decreases the formation of MRE11 and RPA1 foci in response to cisplatin-induced DNA damage. 1 PublicationCorresponds to variant dbSNP:rs16991615Ensembl.1
Natural variantiVAR_050284365S → N. Corresponds to variant dbSNP:rs28403619Ensembl.1
Natural variantiVAR_050285785N → S. Corresponds to variant dbSNP:rs16991638Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041308342 – 357Missing in isoform 3. CuratedAdd BLAST16
Alternative sequenceiVSP_044179408 – 418NSLCPVIFGHE → KWSLALSPRLEYSGAISAHC NLHLPSSNSSPTSACRVAGT TGMRHQTQLLL in isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_015785419 – 465Missing in isoform 2. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ439063 mRNA Translation: CAD27750.1
AY158211 mRNA Translation: AAO21222.1
AK027644 mRNA Translation: BAB55260.1 Different initiation.
AK314654 mRNA Translation: BAG37214.1
AL035461 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10403.1
CH471133 Genomic DNA Translation: EAX10404.1
BC008830 mRNA Translation: AAH08830.2
BC080656 mRNA Translation: AAH80656.1
BC101054 mRNA Translation: AAI01055.1
BC101055 mRNA Translation: AAI01056.1
BC101056 mRNA Translation: AAI01057.1
BC101057 mRNA Translation: AAI01058.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13094.1 [Q9UJA3-1]
CCDS13095.1 [Q9UJA3-3]
CCDS63226.1 [Q9UJA3-2]
CCDS63227.1 [Q9UJA3-4]

NCBI Reference Sequences

More...RefSeqi		NP_001268449.1, NM_001281520.1 [Q9UJA3-1]
NP_001268450.1, NM_001281521.1 [Q9UJA3-4]
NP_001268451.1, NM_001281522.1 [Q9UJA3-2]
NP_115874.3, NM_032485.5 [Q9UJA3-1]
NP_877954.1, NM_182802.2 [Q9UJA3-3]
XP_016883594.1, XM_017028105.1 [Q9UJA3-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000265187; ENSP00000265187; ENSG00000125885 [Q9UJA3-3]
ENST00000378883; ENSP00000368161; ENSG00000125885 [Q9UJA3-2]
ENST00000378886; ENSP00000368164; ENSG00000125885 [Q9UJA3-4]
ENST00000378896; ENSP00000368174; ENSG00000125885 [Q9UJA3-1]
ENST00000610722; ENSP00000478141; ENSG00000125885 [Q9UJA3-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84515

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84515

UCSC genome browser

More...UCSCi		uc002wmi.5 human [Q9UJA3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ439063 mRNA Translation: CAD27750.1
AY158211 mRNA Translation: AAO21222.1
AK027644 mRNA Translation: BAB55260.1 Different initiation.
AK314654 mRNA Translation: BAG37214.1
AL035461 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10403.1
CH471133 Genomic DNA Translation: EAX10404.1
BC008830 mRNA Translation: AAH08830.2
BC080656 mRNA Translation: AAH80656.1
BC101054 mRNA Translation: AAI01055.1
BC101055 mRNA Translation: AAI01056.1
BC101056 mRNA Translation: AAI01057.1
BC101057 mRNA Translation: AAI01058.1
CCDSiCCDS13094.1 [Q9UJA3-1]
CCDS13095.1 [Q9UJA3-3]
CCDS63226.1 [Q9UJA3-2]
CCDS63227.1 [Q9UJA3-4]
RefSeqiNP_001268449.1, NM_001281520.1 [Q9UJA3-1]
NP_001268450.1, NM_001281521.1 [Q9UJA3-4]
NP_001268451.1, NM_001281522.1 [Q9UJA3-2]
NP_115874.3, NM_032485.5 [Q9UJA3-1]
NP_877954.1, NM_182802.2 [Q9UJA3-3]
XP_016883594.1, XM_017028105.1 [Q9UJA3-4]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi124109, 37 interactors
CORUMiQ9UJA3
IntActiQ9UJA3, 23 interactors
MINTiQ9UJA3
STRINGi9606.ENSP00000368164

PTM databases

iPTMnetiQ9UJA3
PhosphoSitePlusiQ9UJA3

Polymorphism and mutation databases

BioMutaiMCM8
DMDMi27805609

Proteomic databases

jPOSTiQ9UJA3
MassIVEiQ9UJA3
PaxDbiQ9UJA3
PeptideAtlasiQ9UJA3
PRIDEiQ9UJA3
ProteomicsDBi17650
84610 [Q9UJA3-1]
84611 [Q9UJA3-2]
84612 [Q9UJA3-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		8265 257 antibodies

Genome annotation databases

EnsembliENST00000265187; ENSP00000265187; ENSG00000125885 [Q9UJA3-3]
ENST00000378883; ENSP00000368161; ENSG00000125885 [Q9UJA3-2]
ENST00000378886; ENSP00000368164; ENSG00000125885 [Q9UJA3-4]
ENST00000378896; ENSP00000368174; ENSG00000125885 [Q9UJA3-1]
ENST00000610722; ENSP00000478141; ENSG00000125885 [Q9UJA3-1]
GeneIDi84515
KEGGihsa:84515
UCSCiuc002wmi.5 human [Q9UJA3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84515
DisGeNETi84515
EuPathDBiHostDB:ENSG00000125885.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		MCM8
HGNCiHGNC:16147 MCM8
HPAiENSG00000125885 Low tissue specificity
MalaCardsiMCM8
MIMi608187 gene
612885 phenotype
neXtProtiNX_Q9UJA3
OpenTargetsiENSG00000125885
Orphaneti619 NON RARE IN EUROPE: Primary ovarian failure
PharmGKBiPA25696

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0480 Eukaryota
COG1241 LUCA
GeneTreeiENSGT00980000198511
HOGENOMiCLU_000995_7_2_1
InParanoidiQ9UJA3
KOiK10737
OMAiSNRSQAK
OrthoDBi266497at2759
PhylomeDBiQ9UJA3
TreeFamiTF323155

Enzyme and pathway databases

ReactomeiR-HSA-113507 E2F-enabled inhibition of pre-replication complex formation
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-176974 Unwinding of DNA
R-HSA-68689 CDC6 association with the ORC:origin complex
R-HSA-68827 CDT1 association with the CDC6:ORC:origin complex
R-HSA-68867 Assembly of the pre-replicative complex
R-HSA-68949 Orc1 removal from chromatin
R-HSA-68962 Activation of the pre-replicative complex

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84515 2 hits in 790 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MCM8 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MCM8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84515
PharosiQ9UJA3 Tbio

Protein Ontology

More...PROi		PR:Q9UJA3
RNActiQ9UJA3 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000125885 Expressed in testis and 186 other tissues
GenevisibleiQ9UJA3 HS

Family and domain databases

InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR031327 MCM
IPR001208 MCM_dom
IPR041562 MCM_lid
IPR033762 MCM_OB
IPR012340 NA-bd_OB-fold
IPR027417 P-loop_NTPase
PANTHERiPTHR11630 PTHR11630, 1 hit
PfamiView protein in Pfam
PF00493 MCM, 1 hit
PF17855 MCM_lid, 1 hit
PF17207 MCM_OB, 1 hit
PRINTSiPR01657 MCMFAMILY
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SM00350 MCM, 1 hit
SUPFAMiSSF50249 SSF50249, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50051 MCM_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMCM8_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UJA3
Secondary accession number(s): B2RBG7
, D3DW08, E7EQU7, Q495R4, Q495R6, Q495R7, Q86US4, Q969I5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: June 1, 2001
Last modified: June 17, 2020
This is version 185 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again