Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger MYM-type protein 5

Gene

ZMYM5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as a transcriptional regulator.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri265 – 299MYM-type 1Add BLAST35
Zinc fingeri311 – 351MYM-type 2Add BLAST41
Zinc fingeri358 – 393MYM-type 3Add BLAST36
Zinc fingeri404 – 431MYM-type 4Add BLAST28

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger MYM-type protein 5
Alternative name(s):
Zinc finger protein 198-like 1
Zinc finger protein 237
Gene namesi
Name:ZMYM5
Synonyms:ZNF198L1, ZNF237
ORF Names:HSPC050
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000132950.18
HGNCiHGNC:13029 ZMYM5
MIMi616443 gene
neXtProtiNX_Q9UJ78

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi112N → H: Abolishes interaction with ETV5. Abolished repression activity. 1 Publication1
Mutagenesisi114S → G: Abolishes interaction with ETV5. No effect on repression activity. 1 Publication1
Mutagenesisi116T → A: No effect on repression activity. 1 Publication1
Mutagenesisi120D → G: Increases repression activity. 1 Publication1

Organism-specific databases

DisGeNETi9205
OpenTargetsiENSG00000132950
PharmGKBiPA37607

Polymorphism and mutation databases

BioMutaiZMYM5
DMDMi212288108

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001913801 – 669Zinc finger MYM-type protein 5Add BLAST669

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki88Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki91Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki134Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki149Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki166Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki443Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki455Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki462Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki552Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiQ9UJ78
MaxQBiQ9UJ78
PaxDbiQ9UJ78
PeptideAtlasiQ9UJ78
PRIDEiQ9UJ78
ProteomicsDBi84596
84597 [Q9UJ78-1]
84598 [Q9UJ78-2]
84599 [Q9UJ78-3]
84600 [Q9UJ78-5]

PTM databases

iPTMnetiQ9UJ78
PhosphoSitePlusiQ9UJ78

Expressioni

Gene expression databases

BgeeiENSG00000132950 Expressed in 211 organ(s), highest expression level in buccal mucosa cell
CleanExiHS_ZMYM5
ExpressionAtlasiQ9UJ78 baseline and differential
GenevisibleiQ9UJ78 HS

Organism-specific databases

HPAiHPA020879

Interactioni

Subunit structurei

Interacts (via N-terminal 120 amino acid region) with ETV5 (via C-terminal).1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SUMO1P631653EBI-7228860,EBI-80140

Protein-protein interaction databases

BioGridi114639, 8 interactors
IntActiQ9UJ78, 10 interactors
MINTiQ9UJ78
STRINGi9606.ENSP00000372361

Structurei

Secondary structure

1669
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UJ78
SMRiQ9UJ78
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UJ78

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi53 – 59Poly-Asp7

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri265 – 299MYM-type 1Add BLAST35
Zinc fingeri311 – 351MYM-type 2Add BLAST41
Zinc fingeri358 – 393MYM-type 3Add BLAST36
Zinc fingeri404 – 431MYM-type 4Add BLAST28

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410JNGQ Eukaryota
ENOG41113IZ LUCA
GeneTreeiENSGT00550000074408
HOVERGENiHBG108767
InParanoidiQ9UJ78
OMAiGTWPRIL
OrthoDBiEOG091G00KQ
PhylomeDBiQ9UJ78

Family and domain databases

InterProiView protein in InterPro
IPR026625 TFII-I-rel
IPR011017 TRASH_dom
IPR010507 Znf_MYM
PANTHERiPTHR11697 PTHR11697, 1 hit
PfamiView protein in Pfam
PF06467 zf-FCS, 3 hits
SMARTiView protein in SMART
SM00746 TRASH, 3 hits

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 4 (identifier: Q9UJ78-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKCSVGGLE LTEQTPALLG NMAMATSLMD IGDSFGHPAC PLVSRSRNSP
60 70 80 90 100
VEDDDDDDDV VFIESIQPPS ISAPAIADQR NFIFASSKNE KPQGNYSVIP
110 120 130 140 150
PSSRDLASQK GNISETIVID DEEDIETNGG AEKKSSCFIE WGLPGTKNKT
160 170 180 190 200
NDLDFSTSSL SRSKTKTGVR PFNPGRMNVA GDLFQNGEFA THHSPDSWIS
210 220 230 240 250
QSASFPSNQK QPGVDSLSPV ALLRKQNFQP TAQQQLTKPA KITCANCKKP
260 270 280 290 300
LQKGQTAYQR KGSAHLFCST TCLSSFSHKR TQNTRSIICK KDASTKKANV
310 320 330 340 350
ILPVESSKSF QEFYSTSCLS PCENNWNLKK GVFNKSRCTI CSKLAEIRHE
360 370 380 390 400
VSVNNVTHKL CSNHCFNKYR LANGLIMNCC EHCGEYMPSK STGNNILVIG
410 420 430 440 450
GQQKRFCCQS CINEYKQMME TKSKKLTASE NRKRNAFREE NEKQLYGSSN
460 470 480 490 500
TLLKKIEGIP EKKEKTSQLQ LSVECGTDTL LIQENVNLPP SSTSTIADTF
510 520 530 540 550
QEQLEEKNFE DSIVPVVLSA DPGTWPRILN IKQRDTLVEN VPPQVRNFNF
560 570 580 590 600
PKDNTGRKFS ETYYTRILPN GEKTTRSWLL YSTSKDSVFC LYCKLFGEGK
610 620 630 640 650
NQLKNENGCK DWQHLSHILS KHEESEMHVN NSVKYSKLKS DLKKNKAIDA
660
AEHRLYENEK NDGVLLLYT
Note: No experimental confirmation available.
Length:669
Mass (Da):74,817
Last modified:July 22, 2008 - v4
Checksum:i3365CE4EFB8D73A9
GO
Isoform 1 (identifier: Q9UJ78-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-382: IRHEVSVNNVTHKLCSNHCFNKYRLANGLIMNCCEH → VWIFIPKLLFRLTVIILTFKCYYVLFHLHNARVLDV
     383-669: Missing.

Show »
Length:382
Mass (Da):42,107
Checksum:iCF8644A504028104
GO
Isoform 2 (identifier: Q9UJ78-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-208: DSWISQSASFPSN → EMHLQRRLMSFFQ
     209-669: Missing.

Show »
Length:208
Mass (Da):22,687
Checksum:i5387088CD2113459
GO
Isoform 3 (identifier: Q9UJ78-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-213: TKTGVRPFNP...SFPSNQKQPG → VNAGMGNSGI...NIIITYKTSL
     214-669: Missing.

Show »
Length:213
Mass (Da):22,729
Checksum:i2CC415998C9BB23E
GO
Isoform 5 (identifier: Q9UJ78-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-176: Missing.

Note: No experimental confirmation available.
Show »
Length:493
Mass (Da):55,907
Checksum:iC718F90BCFD74646
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YH25H0YH25_HUMAN
Zinc finger MYM-type protein 5
ZMYM5
659Annotation score:

Sequence cautioni

The sequence AAF29022 differs from that shown. Reason: Frameshift at positions 286, 322 and 337.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti210K → R in AAF29022 (PubMed:11042152).Curated1
Sequence conflicti214V → M in AAF29022 (PubMed:11042152).Curated1
Sequence conflicti286S → A in AAF29022 (PubMed:11042152).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025508125I → V2 PublicationsCorresponds to variant dbSNP:rs9579718Ensembl.1
Natural variantiVAR_025509137C → F2 PublicationsCorresponds to variant dbSNP:rs9579717Ensembl.1
Natural variantiVAR_062160231T → A. Corresponds to variant dbSNP:rs41292167Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0346451 – 176Missing in isoform 5. CuratedAdd BLAST176
Alternative sequenceiVSP_011442165 – 213TKTGV…QKQPG → VNAGMGNSGITTELTLKYII TNVTTLETGISSVNAGQDVN IIITYKTSL in isoform 3. 2 PublicationsAdd BLAST49
Alternative sequenceiVSP_011443196 – 208DSWIS…SFPSN → EMHLQRRLMSFFQ in isoform 2. 3 PublicationsAdd BLAST13
Alternative sequenceiVSP_011444209 – 669Missing in isoform 2. 3 PublicationsAdd BLAST461
Alternative sequenceiVSP_011445214 – 669Missing in isoform 3. 2 PublicationsAdd BLAST456
Alternative sequenceiVSP_034646347 – 382IRHEV…NCCEH → VWIFIPKLLFRLTVIILTFK CYYVLFHLHNARVLDV in isoform 1. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_034647383 – 669Missing in isoform 1. 1 PublicationAdd BLAST287

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133352 mRNA Translation: CAB57262.1
AJ133353 mRNA Translation: CAB57263.1
AJ133355 mRNA Translation: CAB57265.1
AJ133354 mRNA Translation: CAB57264.1
BT006687 mRNA Translation: AAP35333.1
AK312724 mRNA Translation: BAG35598.1
AL354808 Genomic DNA No translation available.
AL355001 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08238.1
CH471075 Genomic DNA Translation: EAX08240.1
BC007048 mRNA Translation: AAH07048.1
AF161535 mRNA Translation: AAF29022.1 Frameshift.
CCDSiCCDS31942.1 [Q9UJ78-1]
CCDS31943.1 [Q9UJ78-2]
RefSeqiNP_001034738.1, NM_001039649.2 [Q9UJ78-2]
NP_001034739.1, NM_001039650.2 [Q9UJ78-1]
NP_001136156.1, NM_001142684.1 [Q9UJ78-4]
XP_005266650.1, XM_005266593.3 [Q9UJ78-4]
XP_005266651.1, XM_005266594.2 [Q9UJ78-4]
XP_006719957.1, XM_006719894.2 [Q9UJ78-4]
UniGeneiHs.530988

Genome annotation databases

EnsembliENST00000337963; ENSP00000337034; ENSG00000132950 [Q9UJ78-4]
ENST00000382905; ENSP00000372361; ENSG00000132950 [Q9UJ78-1]
ENST00000382907; ENSP00000372364; ENSG00000132950 [Q9UJ78-2]
GeneIDi9205
KEGGihsa:9205
UCSCiuc001umn.4 human [Q9UJ78-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133352 mRNA Translation: CAB57262.1
AJ133353 mRNA Translation: CAB57263.1
AJ133355 mRNA Translation: CAB57265.1
AJ133354 mRNA Translation: CAB57264.1
BT006687 mRNA Translation: AAP35333.1
AK312724 mRNA Translation: BAG35598.1
AL354808 Genomic DNA No translation available.
AL355001 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08238.1
CH471075 Genomic DNA Translation: EAX08240.1
BC007048 mRNA Translation: AAH07048.1
AF161535 mRNA Translation: AAF29022.1 Frameshift.
CCDSiCCDS31942.1 [Q9UJ78-1]
CCDS31943.1 [Q9UJ78-2]
RefSeqiNP_001034738.1, NM_001039649.2 [Q9UJ78-2]
NP_001034739.1, NM_001039650.2 [Q9UJ78-1]
NP_001136156.1, NM_001142684.1 [Q9UJ78-4]
XP_005266650.1, XM_005266593.3 [Q9UJ78-4]
XP_005266651.1, XM_005266594.2 [Q9UJ78-4]
XP_006719957.1, XM_006719894.2 [Q9UJ78-4]
UniGeneiHs.530988

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DASNMR-A229-277[»]
ProteinModelPortaliQ9UJ78
SMRiQ9UJ78
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114639, 8 interactors
IntActiQ9UJ78, 10 interactors
MINTiQ9UJ78
STRINGi9606.ENSP00000372361

PTM databases

iPTMnetiQ9UJ78
PhosphoSitePlusiQ9UJ78

Polymorphism and mutation databases

BioMutaiZMYM5
DMDMi212288108

Proteomic databases

EPDiQ9UJ78
MaxQBiQ9UJ78
PaxDbiQ9UJ78
PeptideAtlasiQ9UJ78
PRIDEiQ9UJ78
ProteomicsDBi84596
84597 [Q9UJ78-1]
84598 [Q9UJ78-2]
84599 [Q9UJ78-3]
84600 [Q9UJ78-5]

Protocols and materials databases

DNASUi9205
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337963; ENSP00000337034; ENSG00000132950 [Q9UJ78-4]
ENST00000382905; ENSP00000372361; ENSG00000132950 [Q9UJ78-1]
ENST00000382907; ENSP00000372364; ENSG00000132950 [Q9UJ78-2]
GeneIDi9205
KEGGihsa:9205
UCSCiuc001umn.4 human [Q9UJ78-4]

Organism-specific databases

CTDi9205
DisGeNETi9205
EuPathDBiHostDB:ENSG00000132950.18
GeneCardsiZMYM5
HGNCiHGNC:13029 ZMYM5
HPAiHPA020879
MIMi616443 gene
neXtProtiNX_Q9UJ78
OpenTargetsiENSG00000132950
PharmGKBiPA37607
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JNGQ Eukaryota
ENOG41113IZ LUCA
GeneTreeiENSGT00550000074408
HOVERGENiHBG108767
InParanoidiQ9UJ78
OMAiGTWPRIL
OrthoDBiEOG091G00KQ
PhylomeDBiQ9UJ78

Miscellaneous databases

ChiTaRSiZMYM5 human
EvolutionaryTraceiQ9UJ78
GenomeRNAii9205
PROiPR:Q9UJ78
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132950 Expressed in 211 organ(s), highest expression level in buccal mucosa cell
CleanExiHS_ZMYM5
ExpressionAtlasiQ9UJ78 baseline and differential
GenevisibleiQ9UJ78 HS

Family and domain databases

InterProiView protein in InterPro
IPR026625 TFII-I-rel
IPR011017 TRASH_dom
IPR010507 Znf_MYM
PANTHERiPTHR11697 PTHR11697, 1 hit
PfamiView protein in Pfam
PF06467 zf-FCS, 3 hits
SMARTiView protein in SMART
SM00746 TRASH, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiZMYM5_HUMAN
AccessioniPrimary (citable) accession number: Q9UJ78
Secondary accession number(s): B2R6V1
, Q5T6E1, Q5T6E2, Q5T6E4, Q96IY6, Q9NZY5, Q9UBW0, Q9UJ77
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: July 22, 2008
Last modified: November 7, 2018
This is version 131 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again