Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UJ78 (ZMYM5_HUMAN)

Entry version 140 (11 Dec 2019)
Sequence version 4 (22 Jul 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger MYM-type protein 5

Gene

ZMYM5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a transcriptional regulator.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri265 – 299MYM-type 1Add BLAST35
Zinc fingeri311 – 351MYM-type 2Add BLAST41
Zinc fingeri358 – 393MYM-type 3Add BLAST36
Zinc fingeri404 – 431MYM-type 4Add BLAST28

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger MYM-type protein 5
Alternative name(s):
Zinc finger protein 198-like 1
Zinc finger protein 237
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZMYM5
Synonyms:ZNF198L1, ZNF237
ORF Names:HSPC050
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000132950.18

Human Gene Nomenclature Database

More...HGNCi		HGNC:13029 ZMYM5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		616443 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UJ78

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi112N → H: Abolishes interaction with ETV5. Abolished repression activity. 1 Publication1
Mutagenesisi114S → G: Abolishes interaction with ETV5. No effect on repression activity. 1 Publication1
Mutagenesisi116T → A: No effect on repression activity. 1 Publication1
Mutagenesisi120D → G: Increases repression activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		9205

Open Targets

More...OpenTargetsi		ENSG00000132950

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37607

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UJ78 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZMYM5

Domain mapping of disease mutations (DMDM)

More...DMDMi		212288108

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001913801 – 669Zinc finger MYM-type protein 5Add BLAST669

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki88Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki91Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki134Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki149Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki166Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki443Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki455Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki462Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki552Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UJ78

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UJ78

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UJ78

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9UJ78

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UJ78

PeptideAtlas

More...PeptideAtlasi		Q9UJ78

PRoteomics IDEntifications database

More...PRIDEi		Q9UJ78

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		84596 [Q9UJ78-4]
84597 [Q9UJ78-1]
84598 [Q9UJ78-2]
84599 [Q9UJ78-3]
84600 [Q9UJ78-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UJ78

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UJ78

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000132950 Expressed in 211 organ(s), highest expression level in buccal mucosa cell

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UJ78 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA015544
HPA020879

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via N-terminal 120 amino acid region) with ETV5 (via C-terminal).

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P631653EBI-7228860,EBI-80140

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		114639, 13 interactors

Protein interaction database and analysis system

More...IntActi		Q9UJ78, 12 interactors

Molecular INTeraction database

More...MINTi		Q9UJ78

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000372361

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UJ78 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1669
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UJ78

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9UJ78

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi53 – 59Poly-Asp7

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri265 – 299MYM-type 1Add BLAST35
Zinc fingeri311 – 351MYM-type 2Add BLAST41
Zinc fingeri358 – 393MYM-type 3Add BLAST36
Zinc fingeri404 – 431MYM-type 4Add BLAST28

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410JNGQ Eukaryota
ENOG41113IZ LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162379

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UJ78

Identification of Orthologs from Complete Genome Data

More...OMAi		TWPRILN

Database of Orthologous Groups

More...OrthoDBi		537563at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UJ78

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011017 TRASH_dom
IPR010507 Znf_MYM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF06467 zf-FCS, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00746 TRASH, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 4 (identifier: Q9UJ78-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKCSVGGLE LTEQTPALLG NMAMATSLMD IGDSFGHPAC PLVSRSRNSP 
        60         70         80         90        100
VEDDDDDDDV VFIESIQPPS ISAPAIADQR NFIFASSKNE KPQGNYSVIP 
       110        120        130        140        150
PSSRDLASQK GNISETIVID DEEDIETNGG AEKKSSCFIE WGLPGTKNKT 
       160        170        180        190        200
NDLDFSTSSL SRSKTKTGVR PFNPGRMNVA GDLFQNGEFA THHSPDSWIS 
       210        220        230        240        250
QSASFPSNQK QPGVDSLSPV ALLRKQNFQP TAQQQLTKPA KITCANCKKP 
       260        270        280        290        300
LQKGQTAYQR KGSAHLFCST TCLSSFSHKR TQNTRSIICK KDASTKKANV 
       310        320        330        340        350
ILPVESSKSF QEFYSTSCLS PCENNWNLKK GVFNKSRCTI CSKLAEIRHE 
       360        370        380        390        400
VSVNNVTHKL CSNHCFNKYR LANGLIMNCC EHCGEYMPSK STGNNILVIG 
       410        420        430        440        450
GQQKRFCCQS CINEYKQMME TKSKKLTASE NRKRNAFREE NEKQLYGSSN 
       460        470        480        490        500
TLLKKIEGIP EKKEKTSQLQ LSVECGTDTL LIQENVNLPP SSTSTIADTF 
       510        520        530        540        550
QEQLEEKNFE DSIVPVVLSA DPGTWPRILN IKQRDTLVEN VPPQVRNFNF 
       560        570        580        590        600
PKDNTGRKFS ETYYTRILPN GEKTTRSWLL YSTSKDSVFC LYCKLFGEGK 
       610        620        630        640        650
NQLKNENGCK DWQHLSHILS KHEESEMHVN NSVKYSKLKS DLKKNKAIDA 
       660 
AEHRLYENEK NDGVLLLYT
Length:669
Mass (Da):74,817
Last modified:July 22, 2008 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3365CE4EFB8D73A9
GO
Isoform 1 (identifier: Q9UJ78-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-382: IRHEVSVNNVTHKLCSNHCFNKYRLANGLIMNCCEH → VWIFIPKLLFRLTVIILTFKCYYVLFHLHNARVLDV
     383-669: Missing.

Show »
Length:382
Mass (Da):42,107
Checksum:iCF8644A504028104
GO
Isoform 2 (identifier: Q9UJ78-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-208: DSWISQSASFPSN → EMHLQRRLMSFFQ
     209-669: Missing.

Show »
Length:208
Mass (Da):22,687
Checksum:i5387088CD2113459
GO
Isoform 3 (identifier: Q9UJ78-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-213: TKTGVRPFNP...SFPSNQKQPG → VNAGMGNSGI...NIIITYKTSL
     214-669: Missing.

Show »
Length:213
Mass (Da):22,729
Checksum:i2CC415998C9BB23E
GO
Isoform 5 (identifier: Q9UJ78-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-176: Missing.

Show »
Length:493
Mass (Da):55,907
Checksum:iC718F90BCFD74646
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF29022 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti210K → R in AAF29022 (PubMed:11042152).Curated1
Sequence conflicti214V → M in AAF29022 (PubMed:11042152).Curated1
Sequence conflicti286S → A in AAF29022 (PubMed:11042152).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_025508125I → V2 PublicationsCorresponds to variant dbSNP:rs9579718Ensembl.1
Natural variantiVAR_025509137C → F2 PublicationsCorresponds to variant dbSNP:rs9579717Ensembl.1
Natural variantiVAR_062160231T → A. Corresponds to variant dbSNP:rs41292167Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0346451 – 176Missing in isoform 5. CuratedAdd BLAST176
Alternative sequenceiVSP_011442165 – 213TKTGV…QKQPG → VNAGMGNSGITTELTLKYII TNVTTLETGISSVNAGQDVN IIITYKTSL in isoform 3. 2 PublicationsAdd BLAST49
Alternative sequenceiVSP_011443196 – 208DSWIS…SFPSN → EMHLQRRLMSFFQ in isoform 2. 3 PublicationsAdd BLAST13
Alternative sequenceiVSP_011444209 – 669Missing in isoform 2. 3 PublicationsAdd BLAST461
Alternative sequenceiVSP_011445214 – 669Missing in isoform 3. 2 PublicationsAdd BLAST456
Alternative sequenceiVSP_034646347 – 382IRHEV…NCCEH → VWIFIPKLLFRLTVIILTFK CYYVLFHLHNARVLDV in isoform 1. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_034647383 – 669Missing in isoform 1. 1 PublicationAdd BLAST287

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ133352 mRNA Translation: CAB57262.1
AJ133353 mRNA Translation: CAB57263.1
AJ133355 mRNA Translation: CAB57265.1
AJ133354 mRNA Translation: CAB57264.1
BT006687 mRNA Translation: AAP35333.1
AK312724 mRNA Translation: BAG35598.1
AL354808 Genomic DNA No translation available.
AL355001 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08238.1
CH471075 Genomic DNA Translation: EAX08240.1
BC007048 mRNA Translation: AAH07048.1
AF161535 mRNA Translation: AAF29022.1 Frameshift.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31942.1 [Q9UJ78-1]
CCDS31943.1 [Q9UJ78-2]

NCBI Reference Sequences

More...RefSeqi		NP_001034738.1, NM_001039649.2 [Q9UJ78-2]
NP_001034739.1, NM_001039650.2 [Q9UJ78-1]
NP_001136156.1, NM_001142684.1 [Q9UJ78-4]
XP_005266650.1, XM_005266593.3 [Q9UJ78-4]
XP_005266651.1, XM_005266594.2 [Q9UJ78-4]
XP_006719957.1, XM_006719894.2 [Q9UJ78-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000337963; ENSP00000337034; ENSG00000132950 [Q9UJ78-4]
ENST00000382905; ENSP00000372361; ENSG00000132950 [Q9UJ78-1]
ENST00000382907; ENSP00000372364; ENSG00000132950 [Q9UJ78-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9205

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9205

UCSC genome browser

More...UCSCi		uc001umn.4 human [Q9UJ78-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133352 mRNA Translation: CAB57262.1
AJ133353 mRNA Translation: CAB57263.1
AJ133355 mRNA Translation: CAB57265.1
AJ133354 mRNA Translation: CAB57264.1
BT006687 mRNA Translation: AAP35333.1
AK312724 mRNA Translation: BAG35598.1
AL354808 Genomic DNA No translation available.
AL355001 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08238.1
CH471075 Genomic DNA Translation: EAX08240.1
BC007048 mRNA Translation: AAH07048.1
AF161535 mRNA Translation: AAF29022.1 Frameshift.
CCDSiCCDS31942.1 [Q9UJ78-1]
CCDS31943.1 [Q9UJ78-2]
RefSeqiNP_001034738.1, NM_001039649.2 [Q9UJ78-2]
NP_001034739.1, NM_001039650.2 [Q9UJ78-1]
NP_001136156.1, NM_001142684.1 [Q9UJ78-4]
XP_005266650.1, XM_005266593.3 [Q9UJ78-4]
XP_005266651.1, XM_005266594.2 [Q9UJ78-4]
XP_006719957.1, XM_006719894.2 [Q9UJ78-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DASNMR-A229-277[»]
SMRiQ9UJ78
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi114639, 13 interactors
IntActiQ9UJ78, 12 interactors
MINTiQ9UJ78
STRINGi9606.ENSP00000372361

PTM databases

iPTMnetiQ9UJ78
PhosphoSitePlusiQ9UJ78

Polymorphism and mutation databases

BioMutaiZMYM5
DMDMi212288108

Proteomic databases

EPDiQ9UJ78
jPOSTiQ9UJ78
MassIVEiQ9UJ78
MaxQBiQ9UJ78
PaxDbiQ9UJ78
PeptideAtlasiQ9UJ78
PRIDEiQ9UJ78
ProteomicsDBi84596 [Q9UJ78-4]
84597 [Q9UJ78-1]
84598 [Q9UJ78-2]
84599 [Q9UJ78-3]
84600 [Q9UJ78-5]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		9205

Genome annotation databases

EnsembliENST00000337963; ENSP00000337034; ENSG00000132950 [Q9UJ78-4]
ENST00000382905; ENSP00000372361; ENSG00000132950 [Q9UJ78-1]
ENST00000382907; ENSP00000372364; ENSG00000132950 [Q9UJ78-2]
GeneIDi9205
KEGGihsa:9205
UCSCiuc001umn.4 human [Q9UJ78-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9205
DisGeNETi9205
EuPathDBiHostDB:ENSG00000132950.18

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZMYM5
HGNCiHGNC:13029 ZMYM5
HPAiHPA015544
HPA020879
MIMi616443 gene
neXtProtiNX_Q9UJ78
OpenTargetsiENSG00000132950
PharmGKBiPA37607

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410JNGQ Eukaryota
ENOG41113IZ LUCA
GeneTreeiENSGT00940000162379
InParanoidiQ9UJ78
OMAiTWPRILN
OrthoDBi537563at2759
PhylomeDBiQ9UJ78

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ZMYM5 human
EvolutionaryTraceiQ9UJ78

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9205
PharosiQ9UJ78 Tdark

Protein Ontology

More...PROi		PR:Q9UJ78
RNActiQ9UJ78 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000132950 Expressed in 211 organ(s), highest expression level in buccal mucosa cell
GenevisibleiQ9UJ78 HS

Family and domain databases

InterProiView protein in InterPro
IPR011017 TRASH_dom
IPR010507 Znf_MYM
PfamiView protein in Pfam
PF06467 zf-FCS, 3 hits
SMARTiView protein in SMART
SM00746 TRASH, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZMYM5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UJ78
Secondary accession number(s): B2R6V1
, Q5T6E1, Q5T6E2, Q5T6E4, Q96IY6, Q9NZY5, Q9UBW0, Q9UJ77
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: July 22, 2008
Last modified: December 11, 2019
This is version 140 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again