Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

MSRA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Catalytic activityi

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin.
L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase

Enzyme and pathway databases

BRENDAi1.8.4.11 2681
ReactomeiR-HSA-5676934 Protein repair

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name:
Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name:
PMSR
Gene namesi
Name:MSRA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000175806.14
HGNCiHGNC:7377 MSRA
MIMi601250 gene
neXtProtiNX_Q9UJ68

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi6R → A: Impaired subcellular location. 1 Publication1
Mutagenesisi7R → A: Impaired subcellular location. 1 Publication1
Mutagenesisi11 – 13Missing : Impaired subcellular location. 3
Mutagenesisi22R → A: Impaired subcellular location. 1 Publication1

Organism-specific databases

DisGeNETi4482
OpenTargetsiENSG00000175806
PharmGKBiPA31182

Chemistry databases

DrugBankiDB00134 L-Methionine

Polymorphism and mutation databases

BioMutaiMSRA
DMDMi12230350

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 23MitochondrionAdd BLAST23
ChainiPRO_000013862624 – 235Mitochondrial peptide methionine sulfoxide reductaseAdd BLAST212

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei106N6-acetyllysine; alternateBy similarity1
Modified residuei106N6-succinyllysine; alternateBy similarity1
Isoform 5 (identifier: Q9UJ68-5)
Lipidationi2N-myristoyl glycine2 Publications1

Keywords - PTMi

Acetylation, Lipoprotein, Myristate

Proteomic databases

EPDiQ9UJ68
PaxDbiQ9UJ68
PeptideAtlasiQ9UJ68
PRIDEiQ9UJ68
ProteomicsDBi84588
84589 [Q9UJ68-2]
84590 [Q9UJ68-3]
84591 [Q9UJ68-4]
84592 [Q9UJ68-5]

PTM databases

iPTMnetiQ9UJ68
PhosphoSitePlusiQ9UJ68

Expressioni

Tissue specificityi

Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.

Gene expression databases

BgeeiENSG00000175806 Expressed in 221 organ(s), highest expression level in cortex of kidney
CleanExiHS_MSRA
ExpressionAtlasiQ9UJ68 baseline and differential
GenevisibleiQ9UJ68 HS

Organism-specific databases

HPAiHPA023804
HPA053069

Interactioni

Protein-protein interaction databases

BioGridi110588, 9 interactors
IntActiQ9UJ68, 6 interactors
STRINGi9606.ENSP00000313921

Structurei

3D structure databases

ProteinModelPortaliQ9UJ68
SMRiQ9UJ68
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG1635 Eukaryota
COG0225 LUCA
GeneTreeiENSGT00390000003823
HOGENOMiHOG000263862
HOVERGENiHBG006401
InParanoidiQ9UJ68
KOiK07304
OMAiMRQGGDI
OrthoDBiEOG091G0MD8
PhylomeDBiQ9UJ68
TreeFamiTF353884

Family and domain databases

Gene3Di3.30.1060.10, 1 hit
HAMAPiMF_01401 MsrA, 1 hit
InterProiView protein in InterPro
IPR002569 Met_Sox_Rdtase_MsrA
IPR036509 Met_Sox_Rdtase_MsrA_sf
PfamiView protein in Pfam
PF01625 PMSR, 1 hit
SUPFAMiSSF55068 SSF55068, 1 hit
TIGRFAMsiTIGR00401 msrA, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. AlignAdd to basket
Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon.

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UJ68-1) [UniParc]FASTAAdd to basket
Also known as: MsrA1, mitoMSRA, a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSATRRACQ LLLLHSLFPV PRMGNSASNI VSPQEALPGR KEQTPVAAKH
60 70 80 90 100
HVNGNRTVEP FPEGTQMAVF GMGCFWGAER KFWVLKGVYS TQVGFAGGYT
110 120 130 140 150
SNPTYKEVCS EKTGHAEVVR VVYQPEHMSF EELLKVFWEN HDPTQGMRQG
160 170 180 190 200
NDHGTQYRSA IYPTSAKQME AALSSKENYQ KVLSEHGFGP ITTDIREGQT
210 220 230
FYYAEDYHQQ YLSKNPNGYC GLGGTGVSCP VGIKK
Note: Mitochondrial. Produced by alternative splicing.
Length:235
Mass (Da):26,132
Last modified:May 1, 2000 - v1
Checksum:iB89A9BBBE4D58D90
GO
Isoform 2 (identifier: Q9UJ68-2) [UniParc]FASTAAdd to basket
Also known as: MsrA2, d

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Note: Cytoplasmic. Produced by alternative promoter usage.
Show »
Length:169
Mass (Da):18,963
Checksum:i4741F1AF6ECA34DC
GO
Isoform 3 (identifier: Q9UJ68-3) [UniParc]FASTAAdd to basket
Also known as: MsrA3, cytoMSRA, c

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAA → MCSEP

Note: Cytoplasmic and nuclear. Produced by alternative promoter usage.
Show »
Length:192
Mass (Da):21,540
Checksum:i0B919D21F23A79A6
GO
Isoform 4 (identifier: Q9UJ68-4) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     71-110: Missing.

Note: Produced by alternative splicing.
Show »
Length:195
Mass (Da):21,737
Checksum:iECDCC13F2C46BA89
GO
Isoform 5 (identifier: Q9UJ68-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: Missing.

Note: Cytoplasmic.2 Publications Produced by alternative initiation.2 Publications
Show »
Length:213
Mass (Da):23,627
Checksum:iA25E9F9AB29DA412
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RIA9E5RIA9_HUMAN
Mitochondrial peptide methionine su...
MSRA
213Annotation score:
E5RJK1E5RJK1_HUMAN
Mitochondrial peptide methionine su...
MSRA
82Annotation score:
H0YAN3H0YAN3_HUMAN
Mitochondrial peptide methionine su...
MSRA
91Annotation score:
E9PJ70E9PJ70_HUMAN
Mitochondrial peptide methionine su...
MSRA
59Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12 – 14Missing in AAG09689 (Ref. 6) Curated3
Sequence conflicti134 – 137LKVF → SRL in AAG09689 (Ref. 6) Curated4

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0414051 – 66Missing in isoform 2. 2 PublicationsAdd BLAST66
Alternative sequenceiVSP_0414061 – 48MLSAT…TPVAA → MCSEP in isoform 3. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_0421321 – 22Missing in isoform 5. CuratedAdd BLAST22
Alternative sequenceiVSP_04140771 – 110Missing in isoform 4. CuratedAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242973 mRNA Translation: CAB59628.1
AY690665 mRNA Translation: AAU11088.1
AY958429 mRNA Translation: AAY17426.1
AY958430 mRNA Translation: AAY17427.1
AY958431 mRNA Translation: AAY17428.1
AY958432 Genomic DNA Translation: AAY17429.1
AY958432 Genomic DNA Translation: AAY17430.1
AY958432 Genomic DNA Translation: AAY17431.1
AK293488 mRNA Translation: BAH11521.1
AF086925 mRNA Translation: AAP97154.1
AF183420 mRNA Translation: AAG09689.1
AC023385 Genomic DNA No translation available.
AC034111 Genomic DNA No translation available.
AC079200 Genomic DNA No translation available.
AC112673 Genomic DNA No translation available.
CH471157 Genomic DNA Translation: EAW65584.1
CH471157 Genomic DNA Translation: EAW65585.1
BC054033 mRNA Translation: AAH54033.1
CCDSiCCDS47798.1 [Q9UJ68-4]
CCDS47799.1 [Q9UJ68-3]
CCDS56522.1 [Q9UJ68-2]
CCDS5975.1 [Q9UJ68-1]
RefSeqiNP_001129142.1, NM_001135670.2 [Q9UJ68-4]
NP_001129143.1, NM_001135671.2 [Q9UJ68-3]
NP_001186658.1, NM_001199729.2 [Q9UJ68-2]
NP_036463.1, NM_012331.4 [Q9UJ68-1]
XP_016868938.1, XM_017013449.1 [Q9UJ68-2]
XP_016868939.1, XM_017013450.1 [Q9UJ68-2]
UniGeneiHs.490981

Genome annotation databases

EnsembliENST00000317173; ENSP00000313921; ENSG00000175806 [Q9UJ68-1]
ENST00000382490; ENSP00000371930; ENSG00000175806 [Q9UJ68-3]
ENST00000441698; ENSP00000410912; ENSG00000175806 [Q9UJ68-4]
ENST00000528246; ENSP00000436839; ENSG00000175806 [Q9UJ68-2]
ENST00000643047; ENSP00000493922; ENSG00000285250 [Q9UJ68-3]
ENST00000643332; ENSP00000495223; ENSG00000285250 [Q9UJ68-4]
ENST00000645254; ENSP00000496174; ENSG00000285250 [Q9UJ68-2]
ENST00000645318; ENSP00000493848; ENSG00000285250 [Q9UJ68-1]
GeneIDi4482
KEGGihsa:4482
UCSCiuc003wsx.4 human [Q9UJ68-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242973 mRNA Translation: CAB59628.1
AY690665 mRNA Translation: AAU11088.1
AY958429 mRNA Translation: AAY17426.1
AY958430 mRNA Translation: AAY17427.1
AY958431 mRNA Translation: AAY17428.1
AY958432 Genomic DNA Translation: AAY17429.1
AY958432 Genomic DNA Translation: AAY17430.1
AY958432 Genomic DNA Translation: AAY17431.1
AK293488 mRNA Translation: BAH11521.1
AF086925 mRNA Translation: AAP97154.1
AF183420 mRNA Translation: AAG09689.1
AC023385 Genomic DNA No translation available.
AC034111 Genomic DNA No translation available.
AC079200 Genomic DNA No translation available.
AC112673 Genomic DNA No translation available.
CH471157 Genomic DNA Translation: EAW65584.1
CH471157 Genomic DNA Translation: EAW65585.1
BC054033 mRNA Translation: AAH54033.1
CCDSiCCDS47798.1 [Q9UJ68-4]
CCDS47799.1 [Q9UJ68-3]
CCDS56522.1 [Q9UJ68-2]
CCDS5975.1 [Q9UJ68-1]
RefSeqiNP_001129142.1, NM_001135670.2 [Q9UJ68-4]
NP_001129143.1, NM_001135671.2 [Q9UJ68-3]
NP_001186658.1, NM_001199729.2 [Q9UJ68-2]
NP_036463.1, NM_012331.4 [Q9UJ68-1]
XP_016868938.1, XM_017013449.1 [Q9UJ68-2]
XP_016868939.1, XM_017013450.1 [Q9UJ68-2]
UniGeneiHs.490981

3D structure databases

ProteinModelPortaliQ9UJ68
SMRiQ9UJ68
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110588, 9 interactors
IntActiQ9UJ68, 6 interactors
STRINGi9606.ENSP00000313921

Chemistry databases

DrugBankiDB00134 L-Methionine

PTM databases

iPTMnetiQ9UJ68
PhosphoSitePlusiQ9UJ68

Polymorphism and mutation databases

BioMutaiMSRA
DMDMi12230350

Proteomic databases

EPDiQ9UJ68
PaxDbiQ9UJ68
PeptideAtlasiQ9UJ68
PRIDEiQ9UJ68
ProteomicsDBi84588
84589 [Q9UJ68-2]
84590 [Q9UJ68-3]
84591 [Q9UJ68-4]
84592 [Q9UJ68-5]

Protocols and materials databases

DNASUi4482
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317173; ENSP00000313921; ENSG00000175806 [Q9UJ68-1]
ENST00000382490; ENSP00000371930; ENSG00000175806 [Q9UJ68-3]
ENST00000441698; ENSP00000410912; ENSG00000175806 [Q9UJ68-4]
ENST00000528246; ENSP00000436839; ENSG00000175806 [Q9UJ68-2]
ENST00000643047; ENSP00000493922; ENSG00000285250 [Q9UJ68-3]
ENST00000643332; ENSP00000495223; ENSG00000285250 [Q9UJ68-4]
ENST00000645254; ENSP00000496174; ENSG00000285250 [Q9UJ68-2]
ENST00000645318; ENSP00000493848; ENSG00000285250 [Q9UJ68-1]
GeneIDi4482
KEGGihsa:4482
UCSCiuc003wsx.4 human [Q9UJ68-1]

Organism-specific databases

CTDi4482
DisGeNETi4482
EuPathDBiHostDB:ENSG00000175806.14
GeneCardsiMSRA
H-InvDBiHIX0168875
HGNCiHGNC:7377 MSRA
HPAiHPA023804
HPA053069
MIMi601250 gene
neXtProtiNX_Q9UJ68
OpenTargetsiENSG00000175806
PharmGKBiPA31182
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1635 Eukaryota
COG0225 LUCA
GeneTreeiENSGT00390000003823
HOGENOMiHOG000263862
HOVERGENiHBG006401
InParanoidiQ9UJ68
KOiK07304
OMAiMRQGGDI
OrthoDBiEOG091G0MD8
PhylomeDBiQ9UJ68
TreeFamiTF353884

Enzyme and pathway databases

BRENDAi1.8.4.11 2681
ReactomeiR-HSA-5676934 Protein repair

Miscellaneous databases

ChiTaRSiMSRA human
GeneWikiiMSRA_(gene)
GenomeRNAii4482
PROiPR:Q9UJ68
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000175806 Expressed in 221 organ(s), highest expression level in cortex of kidney
CleanExiHS_MSRA
ExpressionAtlasiQ9UJ68 baseline and differential
GenevisibleiQ9UJ68 HS

Family and domain databases

Gene3Di3.30.1060.10, 1 hit
HAMAPiMF_01401 MsrA, 1 hit
InterProiView protein in InterPro
IPR002569 Met_Sox_Rdtase_MsrA
IPR036509 Met_Sox_Rdtase_MsrA_sf
PfamiView protein in Pfam
PF01625 PMSR, 1 hit
SUPFAMiSSF55068 SSF55068, 1 hit
TIGRFAMsiTIGR00401 msrA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMSRA_HUMAN
AccessioniPrimary (citable) accession number: Q9UJ68
Secondary accession number(s): E9PAS8
, Q52TC4, Q549N4, Q66MI7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: September 12, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again