Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 176 (22 Apr 2020)
Sequence version 3 (08 May 2019)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rab5 GDP/GTP exchange factor

Gene

RABGEF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Rab effector protein acting as linker between gamma-adaptin, RAB4A or RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates nucleotide exchange on RAB5A. Can act as a ubiquitin ligase (By similarity).By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri13 – 47A20-typePROSITE-ProRule annotationAdd BLAST35

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis, Protein transport, Transport, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8854214 TBC/RABGAPs
R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UJ41

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.F.1.1.5 the synaptosomal vesicle fusion pore (svf-pore) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab5 GDP/GTP exchange factor
Alternative name(s):
RAP1
Rabaptin-5-associated exchange factor for Rab5
Rabex-5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RABGEF1
Synonyms:RABEX5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17676 RABGEF1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609700 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UJ41

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi58A → G: Reduces affinity for ubiquitin 3-fold. 1 Publication1
Mutagenesisi313D → A: Strongly reduced activity. 1 Publication1
Mutagenesisi317P → A: Strongly reduced activity. 1 Publication1
Mutagenesisi354Y → A: Strongly reduced activity. 1 Publication1
Mutagenesisi357T → A: Strongly reduced activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
27342

Open Targets

More...
OpenTargetsi
ENSG00000154710

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134946532

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UJ41 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RABGEF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
56405102

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001913151 – 491Rab5 GDP/GTP exchange factorAdd BLAST491

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei124PhosphoserineCombined sources1
Modified residuei132PhosphoserineCombined sources1
Modified residuei151N6-acetyllysineCombined sources1
Modified residuei170N6-acetyllysineCombined sources1
Modified residuei373PhosphoserineCombined sources1
Modified residuei377PhosphoserineCombined sources1
Modified residuei390PhosphoserineBy similarity1
Modified residuei400PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Monoubiquitinated.

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UJ41

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UJ41

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UJ41

PeptideAtlas

More...
PeptideAtlasi
Q9UJ41

PRoteomics IDEntifications database

More...
PRIDEi
Q9UJ41

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5608
84584 [Q9UJ41-2]
84585 [Q9UJ41-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UJ41

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q9UJ41

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UJ41

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000154710 Expressed in ectocervix and 91 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UJ41 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UJ41 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000154710 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RGS14; the interaction is GTP-dependent (By similarity). Heterodimer with RABEP1. The heterodimer binds RAB4A and RAB5A that have been activated by GTP-binding.

Interacts with RAB21, and with 100-fold lower affinity also with RAB22. Binds TSC2, GGA1, GGA2, GGA3, AP1G1 and AP1G2.

Interacts with ubiquitinated EGFR.

By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118154, 140 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9UJ41

Database of interacting proteins

More...
DIPi
DIP-29348N

Protein interaction database and analysis system

More...
IntActi
Q9UJ41, 74 interactors

Molecular INTeraction database

More...
MINTi
Q9UJ41

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UJ41 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1491
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UJ41

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UJ41

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini232 – 375VPS9PROSITE-ProRule annotationAdd BLAST144

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 74Interaction with ubiquitinated proteinsAdd BLAST74

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri13 – 47A20-typePROSITE-ProRule annotationAdd BLAST35

Keywords - Domaini

Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154540

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UJ41

KEGG Orthology (KO)

More...
KOi
K20131

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECRIHET

Database of Orthologous Groups

More...
OrthoDBi
944088at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UJ41

TreeFam database of animal gene trees

More...
TreeFami
TF321331

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1050.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041545 DUF5601
IPR003123 VPS9
IPR037191 VPS9_dom_sf
IPR002653 Znf_A20

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18151 DUF5601, 1 hit
PF02204 VPS9, 1 hit
PF01754 zf-A20, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00167 VPS9, 1 hit
SM00259 ZnF_A20, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109993 SSF109993, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51205 VPS9, 1 hit
PS51036 ZF_A20, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UJ41-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLKSERRGI HVDQSDLLCK KGCGYYGNPA WQGFCSKCWR EEYHKARQKQ
60 70 80 90 100
IQEDWELAER LQREEEEAFA SSQSSQGAQS LTFSKFEEKK TNEKTRKVTT
110 120 130 140 150
VKKFFSASSR VGSKKEIQEA KAPSPSINRQ TSIETDRVSK EFIEFLKTFH
160 170 180 190 200
KTGQEIYKQT KLFLEGMHYK RDLSIEEQSE CAQDFYHNVA ERMQTRGKVP
210 220 230 240 250
PERVEKIMDQ IEKYIMTRLY KYVFCPETTD DEKKDLAIQK RIRALRWVTP
260 270 280 290 300
QMLCVPVNED IPEVSDMVVK AITDIIEMDS KRVPRDKLAC ITKCSKHIFN
310 320 330 340 350
AIKITKNEPA SADDFLPTLI YIVLKGNPPR LQSNIQYITR FCNPSRLMTG
360 370 380 390 400
EDGYYFTNLC CAVAFIEKLD AQSLNLSQED FDRYMSGQTS PRKQEAESWS
410 420 430 440 450
PDACLGVKQM YKNLDLLSQL NERQERIMNE AKKLEKDLID WTDGIAREVQ
460 470 480 490
DIVEKYPLEI KPPNQPLAAI DSENVENDKL PPPLQPQVYA G
Length:491
Mass (Da):56,891
Last modified:May 8, 2019 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i49ACABA276E65E91
GO
Isoform 2 (identifier: Q9UJ41-3) [UniParc]FASTAAdd to basket
Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     60-60: R → RALLCYPGWSAMVQFQLTATSASWAQVILLLQPPKWLGLQK

Show »
Length:531
Mass (Da):61,332
Checksum:i3241AF02A15D5969
GO
Isoform 3 (identifier: Q9UJ41-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMASSYHEVVSRKKM

Show »
Length:505
Mass (Da):58,526
Checksum:i655A49886ADE2891
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PFK9E9PFK9_HUMAN
Rab5 GDP/GTP exchange factor
RABGEF1
504Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q3HKR1Q3HKR1_HUMAN
RAP1 short isoform
RABGEF1
407Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYI8V9GYI8_HUMAN
Rab5 GDP/GTP exchange factor
RABGEF1
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSJ3A0A0A0MSJ3_HUMAN
RAB guanine nucleotide exchange fac...
RABGEF1 hCG_39434
299Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JDA2C9JDA2_HUMAN
Rab5 GDP/GTP exchange factor
RABGEF1
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PPY0A0A1W2PPY0_HUMAN
Rab5 GDP/GTP exchange factor
RABGEF1
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC87138 differs from that shown. Readthrough transcript KCTD7-RABGEF1.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti270K → R in BAD97049 (Ref. 5) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0601301M → MMASSYHEVVSRKKM in isoform 3. 1
Alternative sequenceiVSP_06013160R → RALLCYPGWSAMVQFQLTAT SASWAQVILLLQPPKWLGLQ K in isoform 2. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ250042 mRNA Translation: CAB57359.1
DQ230533 mRNA Translation: ABA64473.1
DQ230534 mRNA Translation: ABA64474.1
BT007107 mRNA Translation: AAP35771.1
AK127790 mRNA Translation: BAC87138.1 Sequence problems.
AK303006 mRNA Translation: BAG64139.1
AK223329 mRNA Translation: BAD97049.1
AC027644 Genomic DNA Translation: AAQ93362.1
AC079588 Genomic DNA No translation available.
BC015330 mRNA Translation: AAH15330.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5535.1 [Q9UJ41-2]
CCDS69308.1 [Q9UJ41-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001273989.1, NM_001287060.1
NP_001273990.1, NM_001287061.1 [Q9UJ41-4]
NP_001273991.1, NM_001287062.1 [Q9UJ41-2]
NP_055319.1, NM_014504.2 [Q9UJ41-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000284957; ENSP00000284957; ENSG00000154710 [Q9UJ41-2]
ENST00000380828; ENSP00000370208; ENSG00000154710 [Q9UJ41-4]
ENST00000450873; ENSP00000415815; ENSG00000154710 [Q9UJ41-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
27342

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:27342

UCSC genome browser

More...
UCSCi
uc003tvh.4 human [Q9UJ41-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250042 mRNA Translation: CAB57359.1
DQ230533 mRNA Translation: ABA64473.1
DQ230534 mRNA Translation: ABA64474.1
BT007107 mRNA Translation: AAP35771.1
AK127790 mRNA Translation: BAC87138.1 Sequence problems.
AK303006 mRNA Translation: BAG64139.1
AK223329 mRNA Translation: BAD97049.1
AC027644 Genomic DNA Translation: AAQ93362.1
AC079588 Genomic DNA No translation available.
BC015330 mRNA Translation: AAH15330.1
CCDSiCCDS5535.1 [Q9UJ41-2]
CCDS69308.1 [Q9UJ41-4]
RefSeqiNP_001273989.1, NM_001287060.1
NP_001273990.1, NM_001287061.1 [Q9UJ41-4]
NP_001273991.1, NM_001287062.1 [Q9UJ41-2]
NP_055319.1, NM_014504.2 [Q9UJ41-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1TXUX-ray2.35A134-387[»]
2C7MX-ray2.40A17-74[»]
2C7NX-ray2.10A/C/E/G/I/K17-74[»]
2OT3X-ray2.10A134-387[»]
4N3XX-ray2.00A/B/C/D409-455[»]
4N3YX-ray2.20A413-455[»]
4N3ZX-ray3.10A134-452[»]
4Q9UX-ray4.62A/E134-452[»]
SMRiQ9UJ41
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi118154, 140 interactors
CORUMiQ9UJ41
DIPiDIP-29348N
IntActiQ9UJ41, 74 interactors
MINTiQ9UJ41

Protein family/group databases

TCDBi1.F.1.1.5 the synaptosomal vesicle fusion pore (svf-pore) family

PTM databases

iPTMnetiQ9UJ41
MetOSiteiQ9UJ41
PhosphoSitePlusiQ9UJ41

Polymorphism and mutation databases

BioMutaiRABGEF1
DMDMi56405102

Proteomic databases

EPDiQ9UJ41
jPOSTiQ9UJ41
MassIVEiQ9UJ41
PeptideAtlasiQ9UJ41
PRIDEiQ9UJ41
ProteomicsDBi5608
84584 [Q9UJ41-2]
84585 [Q9UJ41-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
14115 128 antibodies

The DNASU plasmid repository

More...
DNASUi
27342

Genome annotation databases

EnsembliENST00000284957; ENSP00000284957; ENSG00000154710 [Q9UJ41-2]
ENST00000380828; ENSP00000370208; ENSG00000154710 [Q9UJ41-4]
ENST00000450873; ENSP00000415815; ENSG00000154710 [Q9UJ41-2]
GeneIDi27342
KEGGihsa:27342
UCSCiuc003tvh.4 human [Q9UJ41-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27342
DisGeNETi27342

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RABGEF1
HGNCiHGNC:17676 RABGEF1
HPAiENSG00000154710 Low tissue specificity
MIMi609700 gene
neXtProtiNX_Q9UJ41
OpenTargetsiENSG00000154710
PharmGKBiPA134946532

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000154540
InParanoidiQ9UJ41
KOiK20131
OMAiECRIHET
OrthoDBi944088at2759
PhylomeDBiQ9UJ41
TreeFamiTF321331

Enzyme and pathway databases

ReactomeiR-HSA-8854214 TBC/RABGAPs
R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs
SIGNORiQ9UJ41

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RABGEF1 human
EvolutionaryTraceiQ9UJ41

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RABGEF1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
27342
PharosiQ9UJ41 Tbio

Protein Ontology

More...
PROi
PR:Q9UJ41
RNActiQ9UJ41 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000154710 Expressed in ectocervix and 91 other tissues
ExpressionAtlasiQ9UJ41 baseline and differential
GenevisibleiQ9UJ41 HS

Family and domain databases

Gene3Di1.20.1050.80, 1 hit
InterProiView protein in InterPro
IPR041545 DUF5601
IPR003123 VPS9
IPR037191 VPS9_dom_sf
IPR002653 Znf_A20
PfamiView protein in Pfam
PF18151 DUF5601, 1 hit
PF02204 VPS9, 1 hit
PF01754 zf-A20, 1 hit
SMARTiView protein in SMART
SM00167 VPS9, 1 hit
SM00259 ZnF_A20, 1 hit
SUPFAMiSSF109993 SSF109993, 1 hit
PROSITEiView protein in PROSITE
PS51205 VPS9, 1 hit
PS51036 ZF_A20, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRABX5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UJ41
Secondary accession number(s): B4DZM7
, Q3HKR2, Q3HKR3, Q53FG0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: May 8, 2019
Last modified: April 22, 2020
This is version 176 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again