Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CCR4-NOT transcription complex subunit 7

Gene

CNOT7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.4 Publications

Catalytic activityi

Exonucleolytic cleavage of poly(A) to 5'-AMP.3 Publications

Cofactori

Mn2+1 Publication, Mg2+1 Publication, Co2+1 PublicationNote: Binds 2 divalent metal cations per subunit with RNAase activity being higher in presence of Mn2+ than of Mg2+ or Co2+.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi40Divalent metal cation 1; catalyticCurated1
Metal bindingi40Divalent metal cation 2; catalyticCurated1
Metal bindingi42Divalent metal cation 2; catalyticCurated1
Metal bindingi161Divalent metal cation 1; catalyticCurated1
Metal bindingi230Divalent metal cation 2; catalyticCurated1
Metal bindingi278Divalent metal cation 1; catalyticCurated1

GO - Molecular functioni

  • 3'-5'-exoribonuclease activity Source: UniProtKB
  • DNA-binding transcription factor activity Source: ProtInc
  • exoribonuclease activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • poly(A)-specific ribonuclease activity Source: UniProtKB
  • RNA binding Source: UniProtKB-KW
  • transcription corepressor activity Source: UniProtKB
  • transcription factor binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionExonuclease, Hydrolase, Nuclease, Repressor, RNA-binding
Biological processRNA-mediated gene silencing, Transcription, Transcription regulation, Translation regulation
LigandMagnesium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Names & Taxonomyi

Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 7 (EC:3.1.13.4)
Alternative name(s):
BTG1-binding factor 1
CCR4-associated factor 1
Short name:
CAF-1
Caf1a
Gene namesi
Name:CNOT7
Synonyms:CAF1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000198791.11
HGNCiHGNC:14101 CNOT7
MIMi604913 gene
neXtProtiNX_Q9UIV1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi40D → N: Abolishes RNA deadenylase activity. 1 Publication1
Mutagenesisi42E → Q: Abolishes RNA deadenylase activity. 1 Publication1
Mutagenesisi138E → K: Abolishes interaction with CNOT1; when associated with Y-142 and K-149. 1 Publication1
Mutagenesisi141M → R: Abolishes interaction with CNOT1. 1 Publication1
Mutagenesisi142T → Y: Abolishes interaction with CNOT1; when associated with K-138 and K-149. 1 Publication1
Mutagenesisi149E → K: Abolishes interaction with CNOT1; when associated with K-138 and Y-142. 1 Publication1
Mutagenesisi161D → N: Abolishes RNA deadenylase activity. Drastically reduces the rate of deadenylation and decay of CBEP3-tethered mRNA. 2 Publications1
Mutagenesisi203K → A: Abolishes interaction with TOB1. 1
Mutagenesisi225H → A: Abolishes RNA deadenylase activity. 1 Publication1
Mutagenesisi230D → N: Abolishes RNA deadenylase activity. 1 Publication1

Organism-specific databases

DisGeNETi29883
OpenTargetsiENSG00000198791
PharmGKBiPA26678

Chemistry databases

ChEMBLiCHEMBL3616361

Polymorphism and mutation databases

BioMutaiCNOT7
DMDMi41713629

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002128441 – 285CCR4-NOT transcription complex subunit 7Add BLAST285

Proteomic databases

EPDiQ9UIV1
PaxDbiQ9UIV1
PeptideAtlasiQ9UIV1
PRIDEiQ9UIV1
ProteomicsDBi84569

PTM databases

iPTMnetiQ9UIV1
PhosphoSitePlusiQ9UIV1

Expressioni

Gene expression databases

BgeeiENSG00000198791 Expressed in 242 organ(s), highest expression level in female gonad
CleanExiHS_CNOT7
ExpressionAtlasiQ9UIV1 baseline and differential
GenevisibleiQ9UIV1 HS

Organism-specific databases

HPAiHPA069543

Interactioni

Subunit structurei

Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits; the complex contains two deadenylase subunits, CNOT6 or CNOT6L, and CNOT7 or CNOT8 (PubMed:19558367). In the complex, interacts directly with CNOT1 (PubMed:21336257). Interacts with AGO2 (By similarity). Interacts with TOB1; recruited by TOB1 to a ternary complex with CPEB3 which is required for mRNA deadenylation and decay (PubMed:21336257, PubMed:23236473, PubMed:19276069). Interacts with BTG1 (By similarity). Interacts with BTG2 (PubMed:23236473). Interacts with NANOS2 (By similarity). Interacts with ZFP36, ZFP36L1 and ZFP36L2; these interactions are inhibited in response to phorbol 12-myristate 13-acetate (PMA) treatment in a p38 MAPK-dependent manner (PubMed:25106868).By similarity6 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi118938, 59 interactors
CORUMiQ9UIV1
DIPiDIP-41902N
IntActiQ9UIV1, 32 interactors
MINTiQ9UIV1
STRINGi9606.ENSP00000355279

Chemistry databases

BindingDBiQ9UIV1

Structurei

Secondary structure

1285
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UIV1
SMRiQ9UIV1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UIV1

Family & Domainsi

Sequence similaritiesi

Belongs to the CAF1 family.Curated

Phylogenomic databases

eggNOGiKOG0304 Eukaryota
COG5228 LUCA
GeneTreeiENSGT00390000000080
HOGENOMiHOG000173077
HOVERGENiHBG051044
InParanoidiQ9UIV1
KOiK12581
OMAiGIRDVWG
OrthoDBiEOG091G0M48
PhylomeDBiQ9UIV1
TreeFamiTF314185

Family and domain databases

Gene3Di3.30.420.10, 1 hit
InterProiView protein in InterPro
IPR006941 RNase_CAF1
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
PfamiView protein in Pfam
PF04857 CAF1, 2 hits
SUPFAMiSSF53098 SSF53098, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UIV1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPAATVDHSQ RICEVWACNL DEEMKKIRQV IRKYNYVAMD TEFPGVVARP
60 70 80 90 100
IGEFRSNADY QYQLLRCNVD LLKIIQLGLT FMNEQGEYPP GTSTWQFNFK
110 120 130 140 150
FNLTEDMYAQ DSIELLTTSG IQFKKHEEEG IETQYFAELL MTSGVVLCEG
160 170 180 190 200
VKWLSFHSGY DFGYLIKILT NSNLPEEELD FFEILRLFFP VIYDVKYLMK
210 220 230 240 250
SCKNLKGGLQ EVAEQLELER IGPQHQAGSD SLLTGMAFFK MREMFFEDHI
260 270 280
DDAKYCGHLY GLGSGSSYVQ NGTGNAYEEE ANKQS
Length:285
Mass (Da):32,745
Last modified:February 2, 2004 - v3
Checksum:i2AF23ED27E06EFDB
GO
Isoform 2 (identifier: Q9UIV1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-285: MFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS → V

Note: No experimental confirmation available.
Show »
Length:244
Mass (Da):28,228
Checksum:i1ECD7111D60414F2
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YBT3H0YBT3_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
91Annotation score:
E5RGA8E5RGA8_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
62Annotation score:
H0YAV9H0YAV9_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
208Annotation score:
E5RGH2E5RGH2_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
147Annotation score:
E5RHV9E5RHV9_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
51Annotation score:
E5RJE0E5RJE0_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
40Annotation score:

Sequence cautioni

The sequence AAF01500 differs from that shown. Reason: Frameshift at position 4.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti4 – 5AT → EL in AAP97145 (PubMed:14702039).Curated2
Sequence conflicti241M → V in BAG51197 (PubMed:16421571).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045497244 – 285MFFED…ANKQS → V in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L46722 mRNA Translation: AAF01500.1 Frameshift.
AF086915 mRNA Translation: AAP97145.1
AK021808 mRNA Translation: BAG51053.1
AK023466 mRNA Translation: BAG51197.1
AC091050 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63820.1
CH471080 Genomic DNA Translation: EAW63821.1
CH471080 Genomic DNA Translation: EAW63822.1
CH471080 Genomic DNA Translation: EAW63823.1
BC060852 mRNA Translation: AAH60852.1
BC070187 mRNA Translation: AAH70187.1
CCDSiCCDS55202.1 [Q9UIV1-2]
CCDS6000.2 [Q9UIV1-1]
RefSeqiNP_001309016.1, NM_001322087.1 [Q9UIV1-2]
NP_001309017.1, NM_001322088.1 [Q9UIV1-2]
NP_001309018.1, NM_001322089.1 [Q9UIV1-2]
NP_001309019.1, NM_001322090.1 [Q9UIV1-1]
NP_001309020.1, NM_001322091.1 [Q9UIV1-1]
NP_001309021.1, NM_001322092.1 [Q9UIV1-1]
NP_001309022.1, NM_001322093.1
NP_001309023.1, NM_001322094.1
NP_001309024.1, NM_001322095.1
NP_001309025.1, NM_001322096.1
NP_001309026.1, NM_001322097.1
NP_001309027.1, NM_001322098.1
NP_001309028.1, NM_001322099.1
NP_001309029.1, NM_001322100.1
NP_037486.2, NM_013354.6 [Q9UIV1-1]
NP_473367.2, NM_054026.3 [Q9UIV1-2]
XP_005273538.1, XM_005273481.2 [Q9UIV1-1]
UniGeneiHs.587465
Hs.645009
Hs.729775

Genome annotation databases

EnsembliENST00000361272; ENSP00000355279; ENSG00000198791 [Q9UIV1-1]
ENST00000523917; ENSP00000429093; ENSG00000198791 [Q9UIV1-2]
GeneIDi29883
KEGGihsa:29883
UCSCiuc003wxg.2 human [Q9UIV1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L46722 mRNA Translation: AAF01500.1 Frameshift.
AF086915 mRNA Translation: AAP97145.1
AK021808 mRNA Translation: BAG51053.1
AK023466 mRNA Translation: BAG51197.1
AC091050 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63820.1
CH471080 Genomic DNA Translation: EAW63821.1
CH471080 Genomic DNA Translation: EAW63822.1
CH471080 Genomic DNA Translation: EAW63823.1
BC060852 mRNA Translation: AAH60852.1
BC070187 mRNA Translation: AAH70187.1
CCDSiCCDS55202.1 [Q9UIV1-2]
CCDS6000.2 [Q9UIV1-1]
RefSeqiNP_001309016.1, NM_001322087.1 [Q9UIV1-2]
NP_001309017.1, NM_001322088.1 [Q9UIV1-2]
NP_001309018.1, NM_001322089.1 [Q9UIV1-2]
NP_001309019.1, NM_001322090.1 [Q9UIV1-1]
NP_001309020.1, NM_001322091.1 [Q9UIV1-1]
NP_001309021.1, NM_001322092.1 [Q9UIV1-1]
NP_001309022.1, NM_001322093.1
NP_001309023.1, NM_001322094.1
NP_001309024.1, NM_001322095.1
NP_001309025.1, NM_001322096.1
NP_001309026.1, NM_001322097.1
NP_001309027.1, NM_001322098.1
NP_001309028.1, NM_001322099.1
NP_001309029.1, NM_001322100.1
NP_037486.2, NM_013354.6 [Q9UIV1-1]
NP_473367.2, NM_054026.3 [Q9UIV1-2]
XP_005273538.1, XM_005273481.2 [Q9UIV1-1]
UniGeneiHs.587465
Hs.645009
Hs.729775

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D5RX-ray2.50A11-262[»]
4GMJX-ray2.70B/D/F1-285[»]
ProteinModelPortaliQ9UIV1
SMRiQ9UIV1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118938, 59 interactors
CORUMiQ9UIV1
DIPiDIP-41902N
IntActiQ9UIV1, 32 interactors
MINTiQ9UIV1
STRINGi9606.ENSP00000355279

Chemistry databases

BindingDBiQ9UIV1
ChEMBLiCHEMBL3616361

PTM databases

iPTMnetiQ9UIV1
PhosphoSitePlusiQ9UIV1

Polymorphism and mutation databases

BioMutaiCNOT7
DMDMi41713629

Proteomic databases

EPDiQ9UIV1
PaxDbiQ9UIV1
PeptideAtlasiQ9UIV1
PRIDEiQ9UIV1
ProteomicsDBi84569

Protocols and materials databases

DNASUi29883
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361272; ENSP00000355279; ENSG00000198791 [Q9UIV1-1]
ENST00000523917; ENSP00000429093; ENSG00000198791 [Q9UIV1-2]
GeneIDi29883
KEGGihsa:29883
UCSCiuc003wxg.2 human [Q9UIV1-1]

Organism-specific databases

CTDi29883
DisGeNETi29883
EuPathDBiHostDB:ENSG00000198791.11
GeneCardsiCNOT7
HGNCiHGNC:14101 CNOT7
HPAiHPA069543
MIMi604913 gene
neXtProtiNX_Q9UIV1
OpenTargetsiENSG00000198791
PharmGKBiPA26678
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0304 Eukaryota
COG5228 LUCA
GeneTreeiENSGT00390000000080
HOGENOMiHOG000173077
HOVERGENiHBG051044
InParanoidiQ9UIV1
KOiK12581
OMAiGIRDVWG
OrthoDBiEOG091G0M48
PhylomeDBiQ9UIV1
TreeFamiTF314185

Enzyme and pathway databases

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Miscellaneous databases

ChiTaRSiCNOT7 human
EvolutionaryTraceiQ9UIV1
GeneWikiiCNOT7
GenomeRNAii29883
PROiPR:Q9UIV1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198791 Expressed in 242 organ(s), highest expression level in female gonad
CleanExiHS_CNOT7
ExpressionAtlasiQ9UIV1 baseline and differential
GenevisibleiQ9UIV1 HS

Family and domain databases

Gene3Di3.30.420.10, 1 hit
InterProiView protein in InterPro
IPR006941 RNase_CAF1
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
PfamiView protein in Pfam
PF04857 CAF1, 2 hits
SUPFAMiSSF53098 SSF53098, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCNOT7_HUMAN
AccessioniPrimary (citable) accession number: Q9UIV1
Secondary accession number(s): A8MZM5
, B3KMP1, B3KN35, D3DSP6, G3V108, Q7Z530
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 14, 2001
Last sequence update: February 2, 2004
Last modified: October 10, 2018
This is version 166 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again