Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 171 (08 May 2019)
Sequence version 3 (02 Feb 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

CCR4-NOT transcription complex subunit 7

Gene

CNOT7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+1 Publication, Mg2+1 Publication, Co2+1 PublicationNote: Binds 2 divalent metal cations per subunit with RNAase activity being higher in presence of Mn2+ than of Mg2+ or Co2+.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi40Divalent metal cation 1; catalyticCurated1
Metal bindingi40Divalent metal cation 2; catalyticCurated1
Metal bindingi42Divalent metal cation 2; catalyticCurated1
Metal bindingi161Divalent metal cation 1; catalyticCurated1
Metal bindingi230Divalent metal cation 2; catalyticCurated1
Metal bindingi278Divalent metal cation 1; catalyticCurated1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionExonuclease, Hydrolase, Nuclease, Repressor, RNA-binding
Biological processRNA-mediated gene silencing, Transcription, Transcription regulation, Translation regulation
LigandMagnesium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 7 (EC:3.1.13.4)
Alternative name(s):
BTG1-binding factor 1
CCR4-associated factor 1
Short name:
CAF-1
Caf1a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CNOT7
Synonyms:CAF1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14101 CNOT7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604913 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UIV1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi40D → N: Abolishes RNA deadenylase activity. 1 Publication1
Mutagenesisi42E → Q: Abolishes RNA deadenylase activity. 1 Publication1
Mutagenesisi138E → K: Abolishes interaction with CNOT1; when associated with Y-142 and K-149. 1 Publication1
Mutagenesisi141M → R: Abolishes interaction with CNOT1. 1 Publication1
Mutagenesisi142T → Y: Abolishes interaction with CNOT1; when associated with K-138 and K-149. 1 Publication1
Mutagenesisi149E → K: Abolishes interaction with CNOT1; when associated with K-138 and Y-142. 1 Publication1
Mutagenesisi161D → N: Abolishes RNA deadenylase activity. Drastically reduces the rate of deadenylation and decay of CBEP3-tethered mRNA. 2 Publications1
Mutagenesisi203K → A: Abolishes interaction with TOB1. 1
Mutagenesisi225H → A: Abolishes RNA deadenylase activity. 1 Publication1
Mutagenesisi230D → N: Abolishes RNA deadenylase activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
29883

Open Targets

More...
OpenTargetsi
ENSG00000198791

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26678

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3616361

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CNOT7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
41713629

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002128441 – 285CCR4-NOT transcription complex subunit 7Add BLAST285

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UIV1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UIV1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UIV1

PeptideAtlas

More...
PeptideAtlasi
Q9UIV1

PRoteomics IDEntifications database

More...
PRIDEi
Q9UIV1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84569

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UIV1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UIV1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198791 Expressed in 242 organ(s), highest expression level in female gonad

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UIV1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UIV1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA069543

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits; the complex contains two deadenylase subunits, CNOT6 or CNOT6L, and CNOT7 or CNOT8 (PubMed:19558367). In the complex, interacts directly with CNOT1 (PubMed:21336257).

Interacts with AGO2 (By similarity).

Interacts with TOB1; recruited by TOB1 to a ternary complex with CPEB3 which is required for mRNA deadenylation and decay (PubMed:21336257, PubMed:23236473, PubMed:19276069).

Interacts with BTG1 (By similarity).

Interacts with BTG2 (PubMed:23236473).

Interacts with NANOS2 (By similarity).

Interacts with ZFP36, ZFP36L1 and ZFP36L2; these interactions are inhibited in response to phorbol 12-myristate 13-acetate (PMA) treatment in a p38 MAPK-dependent manner (PubMed:25106868).

Interacts with TARDBP (PubMed:30520513).

By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118938, 72 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9UIV1

Database of interacting proteins

More...
DIPi
DIP-41902N

Protein interaction database and analysis system

More...
IntActi
Q9UIV1, 34 interactors

Molecular INTeraction database

More...
MINTi
Q9UIV1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000355279

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9UIV1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1285
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UIV1

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UIV1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CAF1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0304 Eukaryota
COG5228 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000080

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000173077

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UIV1

KEGG Orthology (KO)

More...
KOi
K12581

Identification of Orthologs from Complete Genome Data

More...
OMAi
MPSNEEC

Database of Orthologous Groups

More...
OrthoDBi
931256at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UIV1

TreeFam database of animal gene trees

More...
TreeFami
TF314185

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.420.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039636 CNOT7
IPR039637 CNOT7/CNOT8/Pop2
IPR006941 RNase_CAF1
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10797 PTHR10797, 1 hit
PTHR10797:SF2 PTHR10797:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04857 CAF1, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53098 SSF53098, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UIV1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPAATVDHSQ RICEVWACNL DEEMKKIRQV IRKYNYVAMD TEFPGVVARP
60 70 80 90 100
IGEFRSNADY QYQLLRCNVD LLKIIQLGLT FMNEQGEYPP GTSTWQFNFK
110 120 130 140 150
FNLTEDMYAQ DSIELLTTSG IQFKKHEEEG IETQYFAELL MTSGVVLCEG
160 170 180 190 200
VKWLSFHSGY DFGYLIKILT NSNLPEEELD FFEILRLFFP VIYDVKYLMK
210 220 230 240 250
SCKNLKGGLQ EVAEQLELER IGPQHQAGSD SLLTGMAFFK MREMFFEDHI
260 270 280
DDAKYCGHLY GLGSGSSYVQ NGTGNAYEEE ANKQS
Length:285
Mass (Da):32,745
Last modified:February 2, 2004 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2AF23ED27E06EFDB
GO
Isoform 2 (identifier: Q9UIV1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-285: MFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS → V

Note: No experimental confirmation available.
Show »
Length:244
Mass (Da):28,228
Checksum:i1ECD7111D60414F2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YBT3H0YBT3_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGH2E5RGH2_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAV9H0YAV9_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHV9E5RHV9_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGA8E5RGA8_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJE0E5RJE0_HUMAN
CCR4-NOT transcription complex subu...
CNOT7
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF01500 differs from that shown. Reason: Frameshift at position 4.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti4 – 5AT → EL in AAP97145 (PubMed:14702039).Curated2
Sequence conflicti241M → V in BAG51197 (PubMed:16421571).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045497244 – 285MFFED…ANKQS → V in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L46722 mRNA Translation: AAF01500.1 Frameshift.
AF086915 mRNA Translation: AAP97145.1
AK021808 mRNA Translation: BAG51053.1
AK023466 mRNA Translation: BAG51197.1
AC091050 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63820.1
CH471080 Genomic DNA Translation: EAW63821.1
CH471080 Genomic DNA Translation: EAW63822.1
CH471080 Genomic DNA Translation: EAW63823.1
BC060852 mRNA Translation: AAH60852.1
BC070187 mRNA Translation: AAH70187.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55202.1 [Q9UIV1-2]
CCDS6000.2 [Q9UIV1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001309016.1, NM_001322087.1 [Q9UIV1-2]
NP_001309017.1, NM_001322088.1 [Q9UIV1-2]
NP_001309018.1, NM_001322089.1 [Q9UIV1-2]
NP_001309019.1, NM_001322090.1 [Q9UIV1-1]
NP_001309020.1, NM_001322091.1 [Q9UIV1-1]
NP_001309021.1, NM_001322092.1 [Q9UIV1-1]
NP_001309022.1, NM_001322093.1
NP_001309023.1, NM_001322094.1
NP_001309024.1, NM_001322095.1
NP_001309025.1, NM_001322096.1
NP_001309026.1, NM_001322097.1
NP_001309027.1, NM_001322098.1
NP_001309028.1, NM_001322099.1
NP_001309029.1, NM_001322100.1
NP_037486.2, NM_013354.6 [Q9UIV1-1]
NP_473367.2, NM_054026.3 [Q9UIV1-2]
XP_005273538.1, XM_005273481.2 [Q9UIV1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361272; ENSP00000355279; ENSG00000198791 [Q9UIV1-1]
ENST00000523917; ENSP00000429093; ENSG00000198791 [Q9UIV1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29883

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29883

UCSC genome browser

More...
UCSCi
uc003wxg.2 human [Q9UIV1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L46722 mRNA Translation: AAF01500.1 Frameshift.
AF086915 mRNA Translation: AAP97145.1
AK021808 mRNA Translation: BAG51053.1
AK023466 mRNA Translation: BAG51197.1
AC091050 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63820.1
CH471080 Genomic DNA Translation: EAW63821.1
CH471080 Genomic DNA Translation: EAW63822.1
CH471080 Genomic DNA Translation: EAW63823.1
BC060852 mRNA Translation: AAH60852.1
BC070187 mRNA Translation: AAH70187.1
CCDSiCCDS55202.1 [Q9UIV1-2]
CCDS6000.2 [Q9UIV1-1]
RefSeqiNP_001309016.1, NM_001322087.1 [Q9UIV1-2]
NP_001309017.1, NM_001322088.1 [Q9UIV1-2]
NP_001309018.1, NM_001322089.1 [Q9UIV1-2]
NP_001309019.1, NM_001322090.1 [Q9UIV1-1]
NP_001309020.1, NM_001322091.1 [Q9UIV1-1]
NP_001309021.1, NM_001322092.1 [Q9UIV1-1]
NP_001309022.1, NM_001322093.1
NP_001309023.1, NM_001322094.1
NP_001309024.1, NM_001322095.1
NP_001309025.1, NM_001322096.1
NP_001309026.1, NM_001322097.1
NP_001309027.1, NM_001322098.1
NP_001309028.1, NM_001322099.1
NP_001309029.1, NM_001322100.1
NP_037486.2, NM_013354.6 [Q9UIV1-1]
NP_473367.2, NM_054026.3 [Q9UIV1-2]
XP_005273538.1, XM_005273481.2 [Q9UIV1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D5RX-ray2.50A11-262[»]
4GMJX-ray2.70B/D/F1-285[»]
SMRiQ9UIV1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi118938, 72 interactors
CORUMiQ9UIV1
DIPiDIP-41902N
IntActiQ9UIV1, 34 interactors
MINTiQ9UIV1
STRINGi9606.ENSP00000355279

Chemistry databases

BindingDBiQ9UIV1
ChEMBLiCHEMBL3616361

PTM databases

iPTMnetiQ9UIV1
PhosphoSitePlusiQ9UIV1

Polymorphism and mutation databases

BioMutaiCNOT7
DMDMi41713629

Proteomic databases

EPDiQ9UIV1
jPOSTiQ9UIV1
PaxDbiQ9UIV1
PeptideAtlasiQ9UIV1
PRIDEiQ9UIV1
ProteomicsDBi84569

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
29883
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361272; ENSP00000355279; ENSG00000198791 [Q9UIV1-1]
ENST00000523917; ENSP00000429093; ENSG00000198791 [Q9UIV1-2]
GeneIDi29883
KEGGihsa:29883
UCSCiuc003wxg.2 human [Q9UIV1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29883
DisGeNETi29883

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CNOT7
HGNCiHGNC:14101 CNOT7
HPAiHPA069543
MIMi604913 gene
neXtProtiNX_Q9UIV1
OpenTargetsiENSG00000198791
PharmGKBiPA26678

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0304 Eukaryota
COG5228 LUCA
GeneTreeiENSGT00390000000080
HOGENOMiHOG000173077
InParanoidiQ9UIV1
KOiK12581
OMAiMPSNEEC
OrthoDBi931256at2759
PhylomeDBiQ9UIV1
TreeFamiTF314185

Enzyme and pathway databases

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CNOT7 human
EvolutionaryTraceiQ9UIV1

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CNOT7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29883

Protein Ontology

More...
PROi
PR:Q9UIV1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000198791 Expressed in 242 organ(s), highest expression level in female gonad
ExpressionAtlasiQ9UIV1 baseline and differential
GenevisibleiQ9UIV1 HS

Family and domain databases

Gene3Di3.30.420.10, 1 hit
InterProiView protein in InterPro
IPR039636 CNOT7
IPR039637 CNOT7/CNOT8/Pop2
IPR006941 RNase_CAF1
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
PANTHERiPTHR10797 PTHR10797, 1 hit
PTHR10797:SF2 PTHR10797:SF2, 1 hit
PfamiView protein in Pfam
PF04857 CAF1, 2 hits
SUPFAMiSSF53098 SSF53098, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCNOT7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UIV1
Secondary accession number(s): A8MZM5
, B3KMP1, B3KN35, D3DSP6, G3V108, Q7Z530
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 14, 2001
Last sequence update: February 2, 2004
Last modified: May 8, 2019
This is version 171 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again