Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase 13 isoform B

Gene

DUSP13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei138Phosphocysteine intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • phosphatase activity Source: UniProtKB
  • protein tyrosine/serine/threonine phosphatase activity Source: ProtInc
  • protein tyrosine phosphatase activity Source: UniProtKB-EC

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dual specificity protein phosphatase 13 isoform B (EC:3.1.3.16, EC:3.1.3.48)
Short name:
DUSP13B
Alternative name(s):
Dual specificity phosphatase SKRP4
Testis- and skeletal-muscle-specific DSP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DUSP13
Synonyms:DUSP13B, TMDP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000079393.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19681 DUSP13

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613191 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UII6

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51207

Open Targets

More...
OpenTargetsi
ENSG00000079393

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134939640

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DUPD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
257051044

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000948201 – 198Dual specificity protein phosphatase 13 isoform BAdd BLAST198

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UII6

PeptideAtlas

More...
PeptideAtlasi
Q9UII6

PRoteomics IDEntifications database

More...
PRIDEi
Q9UII6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84529
84532 [Q9UII6-4]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q9UII6

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UII6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UII6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000079393 Expressed in 104 organ(s), highest expression level in muscle of leg

CleanEx database of gene expression profiles

More...
CleanExi
HS_DUSP13

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UII6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UII6 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119380, 78 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UII6, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000452702

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UII6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UII6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UII6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini114 – 183Tyrosine-protein phosphataseAdd BLAST70

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1716 Eukaryota
COG2453 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154628

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001524

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UII6

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UII6

TreeFam database of animal gene trees

More...
TreeFami
TF105128

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00127 DSPc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020417 Atypical_DUSP
IPR020405 Atypical_DUSP_famA
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10159 PTHR10159, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00782 DSPc, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01908 ADSPHPHTASE
PR01909 ADSPHPHTASEA

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00195 DSPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UII6-1) [UniParc]FASTAAdd to basket
Also known as: TMDP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSLQKQDLR RPKIHGAVQA SPYQPPTLAS LQRLLWVRQA ATLNHIDEVW
60 70 80 90 100
PSLFLGDAYA ARDKSKLIQL GITHVVNAAA GKFQVDTGAK FYRGMSLEYY
110 120 130 140 150
GIEADDNPFF DLSVYFLPVA RYIRAALSVP QGRVLVHCAM GVSRSATLVL
160 170 180 190
AFLMICENMT LVEAIQTVQA HRNICPNSGF LRQLQVLDNR LGRETGRF
Note: Produced by alternative promoter usage.
Length:198
Mass (Da):22,149
Last modified:September 1, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i82EF05AB74E031EB
GO
Isoform 2 (identifier: Q6B8I1-5) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:60
Mass (Da):6,337
GO
Isoform 4 (identifier: Q9UII6-4) [UniParc]FASTAAdd to basket
Also known as: TMDP-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAM

Note: Produced by alternative promoter usage and alternative splicing.
Show »
Length:248
Mass (Da):27,507
Checksum:iA92045D8C086F866
GO
Isoform 5 (identifier: Q6B8I1-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage.
Length:188
Mass (Da):20,658
GO
Isoform 6 (identifier: Q6B8I1-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:67
Mass (Da):7,195
GO
Isoform 7 (identifier: Q6B8I1-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:92
Mass (Da):9,746
GO
Isoform 8 (identifier: Q6B8I1-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:166
Mass (Da):17,283
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
U3KQ82U3KQ82_HUMAN
Dual-specificity protein phosphatas...
DUSP13
334Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQA1U3KQA1_HUMAN
Dual-specificity protein phosphatas...
DUSP13
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQG1U3KQG1_HUMAN
Dual-specificity protein phosphatas...
DUSP13
260Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQB7U3KQB7_HUMAN
Dual-specificity protein phosphatas...
DUSP13
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PSD4E9PSD4_HUMAN
Dual-specificity protein phosphatas...
DUSP13
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti82K → E in CAG33375 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05713062R → Q. Corresponds to variant dbSNP:rs16932004Ensembl.1
Natural variantiVAR_025431156C → Y1 PublicationCorresponds to variant dbSNP:rs3088142Ensembl.1
Natural variantiVAR_057131190R → G. Corresponds to variant dbSNP:rs16931996Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0378581M → MAETSLPELGGEDKATPCPS ILELEELLRAGKSSCSRVDE VWPNLFIGDAM in isoform 4. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB027004 mRNA Translation: BAA89412.1
AB103375 mRNA Translation: BAD91014.1
CR457094 mRNA Translation: CAG33375.1
AL392111 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54561.1
CH471083 Genomic DNA Translation: EAW54563.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31224.1 [Q9UII6-4]
CCDS7346.1 [Q9UII6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001307772.1, NM_001320843.1 [Q9UII6-1]
NP_057448.3, NM_016364.3 [Q9UII6-1]
XP_005269947.1, XM_005269890.1 [Q9UII6-1]
XP_011538156.1, XM_011539854.2 [Q9UII6-1]
XP_011538157.1, XM_011539855.1 [Q9UII6-1]
XP_011538158.1, XM_011539856.2 [Q9UII6-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.178170

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372700; ENSP00000361785; ENSG00000079393 [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393 [Q9UII6-1]
ENST00000491677; ENSP00000436312; ENSG00000079393 [Q9UII6-1]
ENST00000607131; ENSP00000475801; ENSG00000079393 [Q9UII6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51207

UCSC genome browser

More...
UCSCi
uc001jwr.4 human [Q9UII6-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027004 mRNA Translation: BAA89412.1
AB103375 mRNA Translation: BAD91014.1
CR457094 mRNA Translation: CAG33375.1
AL392111 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54561.1
CH471083 Genomic DNA Translation: EAW54563.1
CCDSiCCDS31224.1 [Q9UII6-4]
CCDS7346.1 [Q9UII6-1]
RefSeqiNP_001307772.1, NM_001320843.1 [Q9UII6-1]
NP_057448.3, NM_016364.3 [Q9UII6-1]
XP_005269947.1, XM_005269890.1 [Q9UII6-1]
XP_011538156.1, XM_011539854.2 [Q9UII6-1]
XP_011538157.1, XM_011539855.1 [Q9UII6-1]
XP_011538158.1, XM_011539856.2 [Q9UII6-1]
UniGeneiHs.178170

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GWOX-ray2.40A/B/C/D1-198[»]
2PQ5X-ray2.30A/B/C/D1-198[»]
ProteinModelPortaliQ9UII6
SMRiQ9UII6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119380, 78 interactors
IntActiQ9UII6, 12 interactors
STRINGi9606.ENSP00000452702

PTM databases

DEPODiQ9UII6
iPTMnetiQ9UII6
PhosphoSitePlusiQ9UII6

Polymorphism and mutation databases

BioMutaiDUPD1
DMDMi257051044

Proteomic databases

PaxDbiQ9UII6
PeptideAtlasiQ9UII6
PRIDEiQ9UII6
ProteomicsDBi84529
84532 [Q9UII6-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51207
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372700; ENSP00000361785; ENSG00000079393 [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393 [Q9UII6-1]
ENST00000491677; ENSP00000436312; ENSG00000079393 [Q9UII6-1]
ENST00000607131; ENSP00000475801; ENSG00000079393 [Q9UII6-1]
GeneIDi51207
UCSCiuc001jwr.4 human [Q9UII6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51207
DisGeNETi51207
EuPathDBiHostDB:ENSG00000079393.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DUSP13
HGNCiHGNC:19681 DUSP13
MIMi613191 gene
neXtProtiNX_Q9UII6
OpenTargetsiENSG00000079393
PharmGKBiPA134939640

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00940000154628
HOVERGENiHBG001524
InParanoidiQ9UII6
PhylomeDBiQ9UII6
TreeFamiTF105128

Miscellaneous databases

EvolutionaryTraceiQ9UII6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51207

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000079393 Expressed in 104 organ(s), highest expression level in muscle of leg
CleanExiHS_DUSP13
ExpressionAtlasiQ9UII6 baseline and differential
GenevisibleiQ9UII6 HS

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR020417 Atypical_DUSP
IPR020405 Atypical_DUSP_famA
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PRINTSiPR01908 ADSPHPHTASE
PR01909 ADSPHPHTASEA
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDS13B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UII6
Secondary accession number(s): A0A024QZR6
, A8K776, A8K782, B3KPY1, B3KXT0, B4DUK0, Q5JSC6, Q6IAR0, Q96GC2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: September 1, 2009
Last modified: December 5, 2018
This is version 154 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again