Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase 13 isoform B

Gene

DUSP13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei138Phosphocysteine intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

  • phosphatase activity Source: UniProtKB
  • protein tyrosine/serine/threonine phosphatase activity Source: ProtInc
  • protein tyrosine phosphatase activity Source: UniProtKB-EC

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 13 isoform B (EC:3.1.3.16, EC:3.1.3.48)
Short name:
DUSP13B
Alternative name(s):
Dual specificity phosphatase SKRP4
Testis- and skeletal-muscle-specific DSP
Gene namesi
Name:DUSP13
Synonyms:DUSP13B, TMDP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000079393.20
HGNCiHGNC:19681 DUSP13
MIMi613191 gene
neXtProtiNX_Q9UII6

Pathology & Biotechi

Organism-specific databases

DisGeNETi51207
OpenTargetsiENSG00000079393
PharmGKBiPA134939640

Polymorphism and mutation databases

BioMutaiDUPD1
DMDMi257051044

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000948201 – 198Dual specificity protein phosphatase 13 isoform BAdd BLAST198

Proteomic databases

PaxDbiQ9UII6
PeptideAtlasiQ9UII6
PRIDEiQ9UII6
ProteomicsDBi84529
84532 [Q9UII6-4]

PTM databases

DEPODiQ9UII6
iPTMnetiQ9UII6
PhosphoSitePlusiQ9UII6

Expressioni

Tissue specificityi

Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000079393 Expressed in 104 organ(s), highest expression level in muscle of leg
CleanExiHS_DUSP13
ExpressionAtlasiQ9UII6 baseline and differential
GenevisibleiQ9UII6 HS

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi119380, 78 interactors
IntActiQ9UII6, 12 interactors
STRINGi9606.ENSP00000452702

Structurei

Secondary structure

1198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UII6
SMRiQ9UII6
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UII6

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini114 – 183Tyrosine-protein phosphataseAdd BLAST70

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00760000118853
HOVERGENiHBG001524
InParanoidiQ9UII6
PhylomeDBiQ9UII6
TreeFamiTF105128

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR020417 Atypical_DUSP
IPR020405 Atypical_DUSP_famA
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PRINTSiPR01908 ADSPHPHTASE
PR01909 ADSPHPHTASEA
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UII6-1) [UniParc]FASTAAdd to basket
Also known as: TMDP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSLQKQDLR RPKIHGAVQA SPYQPPTLAS LQRLLWVRQA ATLNHIDEVW
60 70 80 90 100
PSLFLGDAYA ARDKSKLIQL GITHVVNAAA GKFQVDTGAK FYRGMSLEYY
110 120 130 140 150
GIEADDNPFF DLSVYFLPVA RYIRAALSVP QGRVLVHCAM GVSRSATLVL
160 170 180 190
AFLMICENMT LVEAIQTVQA HRNICPNSGF LRQLQVLDNR LGRETGRF
Note: Produced by alternative promoter usage.
Length:198
Mass (Da):22,149
Last modified:September 1, 2009 - v3
Checksum:i82EF05AB74E031EB
GO
Isoform 2 (identifier: Q6B8I1-5) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:60
Mass (Da):6,337
GO
Isoform 4 (identifier: Q9UII6-4) [UniParc]FASTAAdd to basket
Also known as: TMDP-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAM

Note: Produced by alternative promoter usage and alternative splicing.
Show »
Length:248
Mass (Da):27,507
Checksum:iA92045D8C086F866
GO
Isoform 5 (identifier: Q6B8I1-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage.
Length:188
Mass (Da):20,658
GO
Isoform 6 (identifier: Q6B8I1-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:67
Mass (Da):7,195
GO
Isoform 7 (identifier: Q6B8I1-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:92
Mass (Da):9,746
GO
Isoform 8 (identifier: Q6B8I1-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:166
Mass (Da):17,283
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
U3KQ82U3KQ82_HUMAN
Dual-specificity protein phosphatas...
DUSP13
334Annotation score:
U3KQA1U3KQA1_HUMAN
Dual-specificity protein phosphatas...
DUSP13
220Annotation score:
U3KQG1U3KQG1_HUMAN
Dual-specificity protein phosphatas...
DUSP13
260Annotation score:
U3KQB7U3KQB7_HUMAN
Dual-specificity protein phosphatas...
DUSP13
193Annotation score:
E9PSD4E9PSD4_HUMAN
Dual-specificity protein phosphatas...
DUSP13
147Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti82K → E in CAG33375 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05713062R → Q. Corresponds to variant dbSNP:rs16932004Ensembl.1
Natural variantiVAR_025431156C → Y1 PublicationCorresponds to variant dbSNP:rs3088142Ensembl.1
Natural variantiVAR_057131190R → G. Corresponds to variant dbSNP:rs16931996Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0378581M → MAETSLPELGGEDKATPCPS ILELEELLRAGKSSCSRVDE VWPNLFIGDAM in isoform 4. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027004 mRNA Translation: BAA89412.1
AB103375 mRNA Translation: BAD91014.1
CR457094 mRNA Translation: CAG33375.1
AL392111 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54561.1
CH471083 Genomic DNA Translation: EAW54563.1
CCDSiCCDS31224.1 [Q9UII6-4]
CCDS7346.1 [Q9UII6-1]
RefSeqiNP_001307772.1, NM_001320843.1 [Q9UII6-1]
NP_057448.3, NM_016364.3 [Q9UII6-1]
XP_005269947.1, XM_005269890.1 [Q9UII6-1]
XP_011538156.1, XM_011539854.2 [Q9UII6-1]
XP_011538157.1, XM_011539855.1 [Q9UII6-1]
XP_011538158.1, XM_011539856.2 [Q9UII6-1]
UniGeneiHs.178170

Genome annotation databases

EnsembliENST00000372700; ENSP00000361785; ENSG00000079393 [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393 [Q9UII6-1]
ENST00000491677; ENSP00000436312; ENSG00000079393 [Q9UII6-1]
ENST00000607131; ENSP00000475801; ENSG00000079393 [Q9UII6-1]
GeneIDi51207
UCSCiuc001jwr.4 human [Q9UII6-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027004 mRNA Translation: BAA89412.1
AB103375 mRNA Translation: BAD91014.1
CR457094 mRNA Translation: CAG33375.1
AL392111 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54561.1
CH471083 Genomic DNA Translation: EAW54563.1
CCDSiCCDS31224.1 [Q9UII6-4]
CCDS7346.1 [Q9UII6-1]
RefSeqiNP_001307772.1, NM_001320843.1 [Q9UII6-1]
NP_057448.3, NM_016364.3 [Q9UII6-1]
XP_005269947.1, XM_005269890.1 [Q9UII6-1]
XP_011538156.1, XM_011539854.2 [Q9UII6-1]
XP_011538157.1, XM_011539855.1 [Q9UII6-1]
XP_011538158.1, XM_011539856.2 [Q9UII6-1]
UniGeneiHs.178170

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GWOX-ray2.40A/B/C/D1-198[»]
2PQ5X-ray2.30A/B/C/D1-198[»]
ProteinModelPortaliQ9UII6
SMRiQ9UII6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119380, 78 interactors
IntActiQ9UII6, 12 interactors
STRINGi9606.ENSP00000452702

PTM databases

DEPODiQ9UII6
iPTMnetiQ9UII6
PhosphoSitePlusiQ9UII6

Polymorphism and mutation databases

BioMutaiDUPD1
DMDMi257051044

Proteomic databases

PaxDbiQ9UII6
PeptideAtlasiQ9UII6
PRIDEiQ9UII6
ProteomicsDBi84529
84532 [Q9UII6-4]

Protocols and materials databases

DNASUi51207
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372700; ENSP00000361785; ENSG00000079393 [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393 [Q9UII6-1]
ENST00000491677; ENSP00000436312; ENSG00000079393 [Q9UII6-1]
ENST00000607131; ENSP00000475801; ENSG00000079393 [Q9UII6-1]
GeneIDi51207
UCSCiuc001jwr.4 human [Q9UII6-1]

Organism-specific databases

CTDi51207
DisGeNETi51207
EuPathDBiHostDB:ENSG00000079393.20
GeneCardsiDUSP13
HGNCiHGNC:19681 DUSP13
MIMi613191 gene
neXtProtiNX_Q9UII6
OpenTargetsiENSG00000079393
PharmGKBiPA134939640
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00760000118853
HOVERGENiHBG001524
InParanoidiQ9UII6
PhylomeDBiQ9UII6
TreeFamiTF105128

Miscellaneous databases

EvolutionaryTraceiQ9UII6
GenomeRNAii51207
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000079393 Expressed in 104 organ(s), highest expression level in muscle of leg
CleanExiHS_DUSP13
ExpressionAtlasiQ9UII6 baseline and differential
GenevisibleiQ9UII6 HS

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR020417 Atypical_DUSP
IPR020405 Atypical_DUSP_famA
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PRINTSiPR01908 ADSPHPHTASE
PR01909 ADSPHPHTASEA
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDS13B_HUMAN
AccessioniPrimary (citable) accession number: Q9UII6
Secondary accession number(s): A0A024QZR6
, A8K776, A8K782, B3KPY1, B3KXT0, B4DUK0, Q5JSC6, Q6IAR0, Q96GC2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: September 1, 2009
Last modified: September 12, 2018
This is version 153 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again