Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 159 (22 Apr 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Importin-11

Gene

IPO11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of UBE2E3, and of RPL12 (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Importin-11
Short name:
Imp11
Alternative name(s):
Ran-binding protein 11
Short name:
RanBP11
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IPO11
Synonyms:RANBP11
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20628 IPO11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610889 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UI26

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51194

Open Targets

More...
OpenTargetsi
ENSG00000086200

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134936197

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UI26 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IPO11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50401199

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001207561 – 975Importin-11Add BLAST975

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei343PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UI26

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UI26

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UI26

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UI26

PeptideAtlas

More...
PeptideAtlasi
Q9UI26

PRoteomics IDEntifications database

More...
PRIDEi
Q9UI26

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
84457 [Q9UI26-1]
84458 [Q9UI26-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UI26

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UI26

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000086200 Expressed in kidney and 192 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UI26 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UI26 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000086200 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with UBE2E3 and RPL12.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119368, 91 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UI26, 30 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000386992

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UI26 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UI26

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 100Importin N-terminalPROSITE-ProRule annotationAdd BLAST73
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati123 – 160HEAT 1Add BLAST38
Repeati209 – 248HEAT 2Add BLAST40
Repeati318 – 356HEAT 3Add BLAST39
Repeati422 – 459HEAT 4Add BLAST38
Repeati473 – 509HEAT 5Add BLAST37
Repeati511 – 548HEAT 6Add BLAST38
Repeati555 – 593HEAT 7Add BLAST39
Repeati600 – 636HEAT 8Add BLAST37
Repeati640 – 677HEAT 9Add BLAST38
Repeati683 – 720HEAT 10Add BLAST38
Repeati743 – 764HEAT 11Add BLAST22
Repeati765 – 804HEAT 12Add BLAST40
Repeati819 – 849HEAT 13Add BLAST31
Repeati850 – 887HEAT 14Add BLAST38
Repeati957 – 974HEAT 15Add BLAST18

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the importin beta family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1993 Eukaryota
COG5657 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014071

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003886_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UI26

Identification of Orthologs from Complete Genome Data

More...
OMAi
WLLEEWF

Database of Orthologous Groups

More...
OrthoDBi
228179at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UI26

TreeFam database of animal gene trees

More...
TreeFami
TF324336

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR001494 Importin-beta_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03810 IBN_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00913 IBN_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50166 IMPORTIN_B_NT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UI26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLNSASTVV LQVLTQATSQ DTAVLKPAEE QLKQWETQPG FYSVLLNIFT
60 70 80 90 100
NHTLDINVRW LAVLYFKHGI DRYWRRVAPH ALSEEEKTTL RAGLITNFNE
110 120 130 140 150
PINQIATQIA VLIAKVARLD CPRQWPELIP TLIESVKVQD DLRQHRALLT
160 170 180 190 200
FYHVTKTLAS KRLAADRKLF YDLASGIYNF ACSLWNHHTD TFLQEVSSGN
210 220 230 240 250
EAAILSSLER TLLSLKVLRK LTVNGFVEPH KNMEVMGFLH GIFERLKQFL
260 270 280 290 300
ECSRSIGTDN VCRDRLEKTI ILFTKVLLDF LDQHPFSFTP LIQRSLEFSV
310 320 330 340 350
SYVFTEVGEG VTFERFIVQC MNLIKMIVKN YAYKPSKNFE DSSPETLEAH
360 370 380 390 400
KIKMAFFTYP TLTEICRRLV SHYFLLTEEE LTMWEEDPEG FTVEETGGDS
410 420 430 440 450
WKYSLRPCTE VLFIDIFHEY NQTLTPVLLE MMQTLQGPTN VEDMNALLIK
460 470 480 490 500
DAVYNAVGLA AYELFDSVDF DQWFKNQLLP ELQVIHNRYK PLRRRVIWLI
510 520 530 540 550
GQWISVKFKS DLRPMLYEAI CNLLQDQDLV VRIETATTLK LTVDDFEFRT
560 570 580 590 600
DQFLPYLETM FTLLFQLLQQ VTECDTKMHV LHVLSCVIER VNMQIRPYVG
610 620 630 640 650
CLVQYLPLLW KQSEEHNMLR CAILTTLIHL VQGLGADSKN LYPFLLPVIQ
660 670 680 690 700
LSTDVSQPPH VYLLEDGLEL WLVTLENSPC ITPELLRIFQ NMSPLLELSS
710 720 730 740 750
ENLRTCFKII NGYIFLSSTE FLQTYAVGLC QSFCELLKEI TTEGQVQVLK
760 770 780 790 800
VVENALKVNP ILGPQMFQPI LPYVFKGIIE GERYPVVMST YLGVMGRVLL
810 820 830 840 850
QNTSFFSSLL NEMAHKFNQE MDQLLGNMIE MWVDRMDNIT QPERRKLSAL
860 870 880 890 900
ALLSLLPSDN SVIQDKFCGI INISVEGLHD VMTEDPETGT YKDCMLMSHL
910 920 930 940 950
EEPKVTEDEE PPTEQDKRKK MLALKDPVHT VSLQQFIYEK LKAQQEMLGE
960 970
QGFQSLMETV DTEIVTQLQE FLQGF
Length:975
Mass (Da):112,535
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6A9349B2F8F36DF9
GO
Isoform 2 (identifier: Q9UI26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVQPIIHLGYVVYSLLYLGYKPVQHVTALNTVSSCHKMVSM

Show »
Length:1,015
Mass (Da):117,008
Checksum:iA742D05B81FBD368
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WDV0F8WDV0_HUMAN
Importin-11
IPO11
863Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EMB7E7EMB7_HUMAN
Importin-11
IPO11
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJB1D6RJB1_HUMAN
Importin-11
IPO11
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCN7D6RCN7_HUMAN
Importin-11
IPO11
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCQ2D6RCQ2_HUMAN
Importin-11
IPO11
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8M5H0Y8M5_HUMAN
Importin-11
IPO11
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBN4F8WBN4_HUMAN
Importin-11
IPO11
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53T → A in BAG63985 (PubMed:14702039).Curated1
Sequence conflicti204I → T in BAA91843 (PubMed:14702039).Curated1
Sequence conflicti237G → V in BAG63985 (PubMed:14702039).Curated1
Sequence conflicti332A → T in BAG63985 (PubMed:14702039).Curated1
Sequence conflicti504I → V in BAA91843 (PubMed:14702039).Curated1
Sequence conflicti571V → A in BAA91843 (PubMed:14702039).Curated1
Sequence conflicti722L → S in BAG63985 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050004260N → D. Corresponds to variant dbSNP:rs35107530Ensembl.1
Natural variantiVAR_050005937I → V. Corresponds to variant dbSNP:rs11544795Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0414201M → MVQPIIHLGYVVYSLLYLGY KPVQHVTALNTVSSCHKMVS M in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF111109 mRNA Translation: AAF21936.1
AK302781 mRNA Translation: BAG63985.1
AK001696 mRNA Translation: BAA91843.1
AC008859 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51379.1
CH471137 Genomic DNA Translation: EAW51380.1
BC031694 mRNA Translation: AAH31694.1
BC033776 mRNA Translation: AAH33776.1
AL162083 mRNA Translation: CAB82416.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34167.1 [Q9UI26-1]
CCDS47217.1 [Q9UI26-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T47185

NCBI Reference Sequences

More...
RefSeqi
NP_001128251.1, NM_001134779.1 [Q9UI26-2]
NP_057422.3, NM_016338.4 [Q9UI26-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325324; ENSP00000316651; ENSG00000086200 [Q9UI26-1]
ENST00000409296; ENSP00000386992; ENSG00000086200 [Q9UI26-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51194

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51194

UCSC genome browser

More...
UCSCi
uc003jtc.4 human [Q9UI26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF111109 mRNA Translation: AAF21936.1
AK302781 mRNA Translation: BAG63985.1
AK001696 mRNA Translation: BAA91843.1
AC008859 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51379.1
CH471137 Genomic DNA Translation: EAW51380.1
BC031694 mRNA Translation: AAH31694.1
BC033776 mRNA Translation: AAH33776.1
AL162083 mRNA Translation: CAB82416.1
CCDSiCCDS34167.1 [Q9UI26-1]
CCDS47217.1 [Q9UI26-2]
PIRiT47185
RefSeqiNP_001128251.1, NM_001134779.1 [Q9UI26-2]
NP_057422.3, NM_016338.4 [Q9UI26-1]

3D structure databases

SMRiQ9UI26
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119368, 91 interactors
IntActiQ9UI26, 30 interactors
STRINGi9606.ENSP00000386992

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

PTM databases

iPTMnetiQ9UI26
PhosphoSitePlusiQ9UI26

Polymorphism and mutation databases

BioMutaiIPO11
DMDMi50401199

Proteomic databases

EPDiQ9UI26
jPOSTiQ9UI26
MassIVEiQ9UI26
PaxDbiQ9UI26
PeptideAtlasiQ9UI26
PRIDEiQ9UI26
ProteomicsDBi84457 [Q9UI26-1]
84458 [Q9UI26-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23693 197 antibodies

The DNASU plasmid repository

More...
DNASUi
51194

Genome annotation databases

EnsembliENST00000325324; ENSP00000316651; ENSG00000086200 [Q9UI26-1]
ENST00000409296; ENSP00000386992; ENSG00000086200 [Q9UI26-2]
GeneIDi51194
KEGGihsa:51194
UCSCiuc003jtc.4 human [Q9UI26-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51194
DisGeNETi51194

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IPO11
HGNCiHGNC:20628 IPO11
HPAiENSG00000086200 Low tissue specificity
MIMi610889 gene
neXtProtiNX_Q9UI26
OpenTargetsiENSG00000086200
PharmGKBiPA134936197

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1993 Eukaryota
COG5657 LUCA
GeneTreeiENSGT00390000014071
HOGENOMiCLU_003886_0_0_1
InParanoidiQ9UI26
OMAiWLLEEWF
OrthoDBi228179at2759
PhylomeDBiQ9UI26
TreeFamiTF324336

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IPO11 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
IPO11

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51194
PharosiQ9UI26 Tbio

Protein Ontology

More...
PROi
PR:Q9UI26
RNActiQ9UI26 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000086200 Expressed in kidney and 192 other tissues
ExpressionAtlasiQ9UI26 baseline and differential
GenevisibleiQ9UI26 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR001494 Importin-beta_N
PfamiView protein in Pfam
PF03810 IBN_N, 1 hit
SMARTiView protein in SMART
SM00913 IBN_N, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50166 IMPORTIN_B_NT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIPO11_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UI26
Secondary accession number(s): A6NGJ5
, B4DZ73, D3DW98, Q8N5R2, Q9NSJ6, Q9NVB1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: May 1, 2000
Last modified: April 22, 2020
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again