Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UI08 (EVL_HUMAN)

Entry version 179 (18 Sep 2019)
Sequence version 2 (15 Nov 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ena/VASP-like protein

Gene

EVL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. EVL enhances actin nucleation and polymerization.

Miscellaneous

Required to transform actin polymerization into active movement for the propulsive force of Listeria monocytogenes.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-202433 Generation of second messenger molecules
R-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9UI08

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ena/VASP-like protein
Alternative name(s):
Ena/vasodilator-stimulated phosphoprotein-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EVL
Synonyms:RNB6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:20234 EVL

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UI08

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		51466

Open Targets

More...OpenTargetsi		ENSG00000196405

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134890866

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		EVL

Domain mapping of disease mutations (DMDM)

More...DMDMi		25090276

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000871041 – 416Ena/VASP-like proteinAdd BLAST416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei130PhosphoserineBy similarity1
Modified residuei246PhosphoserineCombined sources1
Modified residuei259PhosphoserineBy similarity1
Modified residuei304PhosphoserineCombined sources1
Modified residuei306PhosphoserineCombined sources1
Modified residuei329PhosphoserineCombined sources1
Modified residuei331PhosphoserineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Modified residuei349PhosphoserineCombined sources1
Modified residuei354PhosphoserineCombined sources1
Modified residuei369PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by PKA; phosphorylation abolishes binding to SH3 domains of ABL and SRC.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UI08

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UI08

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UI08

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UI08

PeptideAtlas

More...PeptideAtlasi		Q9UI08

PRoteomics IDEntifications database

More...PRIDEi		Q9UI08

ProteomicsDB human proteome resource

More...ProteomicsDBi		6523
84445 [Q9UI08-1]
84446 [Q9UI08-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UI08

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UI08

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000196405 Expressed in 222 organ(s), highest expression level in right hemisphere of cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UI08 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UI08 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB033987
HPA018849
HPA019536

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer (By similarity). Binds to the SH3 domains of ABL1, LYN and SRC. Also binds to profilin, with preference for isoform IIa of PFN2, and the WW domain of APBB1/FE65. Binds to SEMA6A.

Interacts, via the Pro-rich region, with the C-terminal SH3 domain of DNMBP.

Interacts with RAPH1. Binds, via the EVH1 domain, the Pro-rich domain of Listeria monocytogenes actA (By similarity). Binds, via the EVH1 domain, the Pro-rich domain of ZYX.

Interacts with FYB1 (PubMed:10747096).

Interacts with ZDHHC17 (PubMed:28882895).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		119556, 45 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q9UI08

Protein interaction database and analysis system

More...IntActi		Q9UI08, 34 interactors

Molecular INTeraction database

More...MINTi		Q9UI08

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000376652

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UI08

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 112WH1PROSITE-ProRule annotationAdd BLAST112

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni222 – 413EVH2Add BLAST192
Regioni222 – 242EVH2 block AAdd BLAST21
Regioni265 – 282EVH2 block BAdd BLAST18
Regioni342 – 362Required for interaction with ZDHHC171 PublicationAdd BLAST21
Regioni379 – 413EVH2 block CAdd BLAST35

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi231 – 234KLKR4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi162 – 206Pro-richAdd BLAST45

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The EVH2 domain is comprised of 3 regions. Block A is a thymosin-like domain required for G-actin binding. The KLKR motif within this block is essential for the G-actin binding and for actin polymerization. Block B is required for F-actin binding and subcellular location, and Block C for tetramerization.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Ena/VASP family.Curated

Keywords - Domaini

SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IQ1Z Eukaryota
ENOG410YM7V LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157826

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000013015

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UI08

KEGG Orthology (KO)

More...KOi		K23487

Identification of Orthologs from Complete Genome Data

More...OMAi		ESQMEDP

Database of Orthologous Groups

More...OrthoDBi		972128at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UI08

TreeFam database of animal gene trees

More...TreeFami		TF321411

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.5.1160, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR034319 ENA/VASP-like_protein
IPR042180 IF_rod_dom_coil1B
IPR011993 PH-like_dom_sf
IPR017354 VASP/EVL
IPR038023 VASP_sf
IPR014885 VASP_tetra
IPR000697 WH1/EVH1_dom

The PANTHER Classification System

More...PANTHERi		PTHR11202:SF4 PTHR11202:SF4, 2 hits

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08776 VASP_tetra, 1 hit
PF00568 WH1, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF038010 Vasodilator_Phospo, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00461 WH1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF118370 SSF118370, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50229 WH1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q9UI08-1) [UniParc]FASTAAdd to basket
Also known as: EVL-I

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEQSICQAR ASVMVYDDTS KKWVPIKPGQ QGFSRINIYH NTASNTFRVV 
        60         70         80         90        100
GVKLQDQQVV INYSIVKGLK YNQATPTFHQ WRDARQVYGL NFASKEEATT 
       110        120        130        140        150
FSNAMLFALN IMNSQEGGPS SQRQVQNGPS PDEMDIQRRQ VMEQHQQQRQ 
       160        170        180        190        200
ESLERRTSAT GPILPPGHPS SAASAPVSCS GPPPPPPPPV PPPPTGATPP 
       210        220        230        240        250
PPPPLPAGGA QGSSHDESSM SGLAAAIAGA KLRRVQRPED ASGGSSPSGT 
       260        270        280        290        300
SKSDANRASS GGGGGGLMEE MNKLLAKRRK AASQSDKPAE KKEDESQMED 
       310        320        330        340        350
PSTSPSPGTR AASQPPNSSE AGRKPWERSN SVEKPVSSIL SRTPSVAKSP 
       360        370        380        390        400
EAKSPLQSQP HSRMKPAGSV NDMALDAFDL DRMKQEILEE VVRELHKVKE 
       410 
EIIDAIRQEL SGISTT
Length:416
Mass (Da):44,620
Last modified:November 15, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAD5B67458755D659
GO
Isoform 1 (identifier: Q9UI08-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAT

Show »
Length:418
Mass (Da):44,792
Checksum:iBFCCF68CF923720C
GO
Isoform 3 (identifier: Q9UI08-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFAFEEF
     364-416: MKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT → YRTTLLLTCPPGFGAPLSPVP

Note: No experimental confirmation available.
Show »
Length:390
Mass (Da):41,577
Checksum:iF2E44B1B78751A0F
GO
Isoform 4 (identifier: Q9UI08-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     368-397: Missing.

Show »
Length:386
Mass (Da):41,136
Checksum:i13FE2387BF9C4F3C
GO
Isoform 5 (identifier: Q9UI08-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAT
     342-362: Missing.

Show »
Length:397
Mass (Da):42,578
Checksum:i738CD949799827C0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YJN0H0YJN0_HUMAN
Ena/VASP-like protein
EVL
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V5F7G3V5F7_HUMAN
Ena/VASP-like protein
EVL
168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V314G3V314_HUMAN
Ena/VASP-like protein
EVL
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJL6H0YJL6_HUMAN
Ena/VASP-like protein
EVL
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V3G2G3V3G2_HUMAN
Ena/VASP-like protein
EVL
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V535G3V535_HUMAN
Ena/VASP-like protein
EVL
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2K5G3V2K5_HUMAN
Ena/VASP-like protein
EVL
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYI2A0A087WYI2_HUMAN
Ena/VASP-like protein
EVL
283Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti201P → S in AAF17197 (PubMed:10931946).Curated1
Sequence conflicti329S → N in AAP97156 (Ref. 2) Curated1
Sequence conflicti364M → Y in CAB63763 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036464188P → L in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs367737727Ensembl.1
Natural variantiVAR_036465247P → L in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0040441M → MAT in isoform 1 and isoform 5. 4 Publications1
Alternative sequenceiVSP_0573221M → MFAFEEF in isoform 3. 1 Publication1
Alternative sequenceiVSP_058778342 – 362Missing in isoform 5. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_057323364 – 416MKPAG…GISTT → YRTTLLLTCPPGFGAPLSPV P in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_058779368 – 397Missing in isoform 4. Add BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF052504 mRNA Translation: AAF21709.1
AF087843 mRNA Translation: AAP97156.1
AF112209 mRNA Translation: AAF17197.1
AK289720 mRNA Translation: BAF82409.1
AK295919 mRNA Translation: BAH12221.1
AL133368 Genomic DNA No translation available.
AL133523 Genomic DNA No translation available.
AL157912 Genomic DNA No translation available.
KF456005 Genomic DNA No translation available.
KF456007 Genomic DNA No translation available.
KF456010 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81684.1
BC023997 mRNA Translation: AAH23997.1
BC032358 mRNA Translation: AAH32358.1
AF131766 mRNA Translation: AAD20040.1
AL133642 mRNA Translation: CAB63763.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS81851.1 [Q9UI08-1]
CCDS9955.1 [Q9UI08-2]

NCBI Reference Sequences

More...RefSeqi		NP_001317150.1, NM_001330221.1 [Q9UI08-1]
NP_057421.1, NM_016337.2 [Q9UI08-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000392920; ENSP00000376652; ENSG00000196405 [Q9UI08-2]
ENST00000402714; ENSP00000384720; ENSG00000196405 [Q9UI08-1]
ENST00000544450; ENSP00000437904; ENSG00000196405 [Q9UI08-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		51466

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:51466

UCSC genome browser

More...UCSCi		uc001ygt.4 human [Q9UI08-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF052504 mRNA Translation: AAF21709.1
AF087843 mRNA Translation: AAP97156.1
AF112209 mRNA Translation: AAF17197.1
AK289720 mRNA Translation: BAF82409.1
AK295919 mRNA Translation: BAH12221.1
AL133368 Genomic DNA No translation available.
AL133523 Genomic DNA No translation available.
AL157912 Genomic DNA No translation available.
KF456005 Genomic DNA No translation available.
KF456007 Genomic DNA No translation available.
KF456010 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81684.1
BC023997 mRNA Translation: AAH23997.1
BC032358 mRNA Translation: AAH32358.1
AF131766 mRNA Translation: AAD20040.1
AL133642 mRNA Translation: CAB63763.2
CCDSiCCDS81851.1 [Q9UI08-1]
CCDS9955.1 [Q9UI08-2]
RefSeqiNP_001317150.1, NM_001330221.1 [Q9UI08-1]
NP_057421.1, NM_016337.2 [Q9UI08-2]

3D structure databases

SMRiQ9UI08
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119556, 45 interactors
ELMiQ9UI08
IntActiQ9UI08, 34 interactors
MINTiQ9UI08
STRINGi9606.ENSP00000376652

PTM databases

iPTMnetiQ9UI08
PhosphoSitePlusiQ9UI08

Polymorphism and mutation databases

BioMutaiEVL
DMDMi25090276

Proteomic databases

EPDiQ9UI08
jPOSTiQ9UI08
MassIVEiQ9UI08
PaxDbiQ9UI08
PeptideAtlasiQ9UI08
PRIDEiQ9UI08
ProteomicsDBi6523
84445 [Q9UI08-1]
84446 [Q9UI08-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		51466
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392920; ENSP00000376652; ENSG00000196405 [Q9UI08-2]
ENST00000402714; ENSP00000384720; ENSG00000196405 [Q9UI08-1]
ENST00000544450; ENSP00000437904; ENSG00000196405 [Q9UI08-3]
GeneIDi51466
KEGGihsa:51466
UCSCiuc001ygt.4 human [Q9UI08-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51466
DisGeNETi51466

GeneCards: human genes, protein and diseases

More...GeneCardsi		EVL
HGNCiHGNC:20234 EVL
HPAiCAB033987
HPA018849
HPA019536
neXtProtiNX_Q9UI08
OpenTargetsiENSG00000196405
PharmGKBiPA134890866

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IQ1Z Eukaryota
ENOG410YM7V LUCA
GeneTreeiENSGT00940000157826
HOGENOMiHOG000013015
InParanoidiQ9UI08
KOiK23487
OMAiESQMEDP
OrthoDBi972128at2759
PhylomeDBiQ9UI08
TreeFamiTF321411

Enzyme and pathway databases

ReactomeiR-HSA-202433 Generation of second messenger molecules
R-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins
SignaLinkiQ9UI08

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		EVL human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Enah/Vasp-like

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		51466

Pharos

More...Pharosi		Q9UI08

Protein Ontology

More...PROi		PR:Q9UI08

Gene expression databases

BgeeiENSG00000196405 Expressed in 222 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiQ9UI08 baseline and differential
GenevisibleiQ9UI08 HS

Family and domain databases

Gene3Di1.20.5.1160, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR034319 ENA/VASP-like_protein
IPR042180 IF_rod_dom_coil1B
IPR011993 PH-like_dom_sf
IPR017354 VASP/EVL
IPR038023 VASP_sf
IPR014885 VASP_tetra
IPR000697 WH1/EVH1_dom
PANTHERiPTHR11202:SF4 PTHR11202:SF4, 2 hits
PfamiView protein in Pfam
PF08776 VASP_tetra, 1 hit
PF00568 WH1, 1 hit
PIRSFiPIRSF038010 Vasodilator_Phospo, 1 hit
SMARTiView protein in SMART
SM00461 WH1, 1 hit
SUPFAMiSSF118370 SSF118370, 1 hit
PROSITEiView protein in PROSITE
PS50229 WH1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEVL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UI08
Secondary accession number(s): A8K105
, B7Z3I5, O95884, Q7Z522, Q8TBV1, Q9UF25, Q9UIC2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: November 15, 2002
Last modified: September 18, 2019
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again