Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ena/VASP-like protein

Gene

EVL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. EVL enhances actin nucleation and polymerization.

Miscellaneous

Required to transform actin polymerization into active movement for the propulsive force of Listeria monocytogenes.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

ReactomeiR-HSA-202433 Generation of second messenger molecules
R-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins
SignaLinkiQ9UI08

Names & Taxonomyi

Protein namesi
Recommended name:
Ena/VASP-like protein
Alternative name(s):
Ena/vasodilator-stimulated phosphoprotein-like
Gene namesi
Name:EVL
Synonyms:RNB6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000196405.12
HGNCiHGNC:20234 EVL
neXtProtiNX_Q9UI08

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi51466
OpenTargetsiENSG00000196405
PharmGKBiPA134890866

Polymorphism and mutation databases

BioMutaiEVL
DMDMi25090276

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000871041 – 416Ena/VASP-like proteinAdd BLAST416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei130PhosphoserineBy similarity1
Modified residuei246PhosphoserineCombined sources1
Modified residuei259PhosphoserineBy similarity1
Modified residuei304PhosphoserineCombined sources1
Modified residuei306PhosphoserineCombined sources1
Modified residuei329PhosphoserineCombined sources1
Modified residuei331PhosphoserineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Modified residuei349PhosphoserineCombined sources1
Modified residuei354PhosphoserineCombined sources1
Modified residuei369PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by PKA; phosphorylation abolishes binding to SH3 domains of ABL and SRC.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UI08
PaxDbiQ9UI08
PeptideAtlasiQ9UI08
PRIDEiQ9UI08
ProteomicsDBi84445
84446 [Q9UI08-2]

PTM databases

iPTMnetiQ9UI08
PhosphoSitePlusiQ9UI08

Expressioni

Gene expression databases

BgeeiENSG00000196405 Expressed in 222 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_EVL
ExpressionAtlasiQ9UI08 baseline and differential
GenevisibleiQ9UI08 HS

Organism-specific databases

HPAiCAB033987
HPA018849
HPA019536

Interactioni

Subunit structurei

Homotetramer (By similarity). Binds to the SH3 domains of ABL1, LYN and SRC. Also binds to profilin, with preference for isoform IIa of PFN2, and the WW domain of APBB1/FE65. Binds to SEMA6A. Interacts, via the Pro-rich region, with the C-terminal SH3 domain of DNMBP. Interacts with RAPH1. Binds, via the EVH1 domain, the Pro-rich domain of Listeria monocytogenes actA (By similarity). Binds, via the EVH1 domain, the Pro-rich domain of ZYX. Interacts with FYB1 (PubMed:10747096). Interacts with ZDHHC17 (PubMed:28882895).By similarity5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119556, 45 interactors
ELMiQ9UI08
IntActiQ9UI08, 17 interactors
MINTiQ9UI08
STRINGi9606.ENSP00000376652

Structurei

3D structure databases

ProteinModelPortaliQ9UI08
SMRiQ9UI08
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 112WH1PROSITE-ProRule annotationAdd BLAST112

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni222 – 413EVH2Add BLAST192
Regioni222 – 242EVH2 block AAdd BLAST21
Regioni265 – 282EVH2 block BAdd BLAST18
Regioni342 – 362Required for interaction with ZDHHC171 PublicationAdd BLAST21
Regioni379 – 413EVH2 block CAdd BLAST35

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi231 – 234KLKR4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi162 – 206Pro-richAdd BLAST45

Domaini

The EVH2 domain is comprised of 3 regions. Block A is a thymosin-like domain required for G-actin binding. The KLKR motif within this block is essential for the G-actin binding and for actin polymerization. Block B is required for F-actin binding and subcellular location, and Block C for tetramerization.

Sequence similaritiesi

Belongs to the Ena/VASP family.Curated

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiENOG410IQ1Z Eukaryota
ENOG410YM7V LUCA
GeneTreeiENSGT00730000110272
HOGENOMiHOG000013015
HOVERGENiHBG006655
InParanoidiQ9UI08
OMAiESQMEDP
OrthoDBiEOG091G0QTE
PhylomeDBiQ9UI08
TreeFamiTF321411

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR034319 ENA/VASP-like_protein
IPR011993 PH-like_dom_sf
IPR017354 VASP/EVL
IPR038023 VASP_sf
IPR014885 VASP_tetra
IPR000697 WH1/EVH1_dom
PANTHERiPTHR11202:SF4 PTHR11202:SF4, 1 hit
PfamiView protein in Pfam
PF08776 VASP_tetra, 1 hit
PF00568 WH1, 1 hit
PIRSFiPIRSF038010 Vasodilator_Phospo, 1 hit
SMARTiView protein in SMART
SM00461 WH1, 1 hit
SUPFAMiSSF118370 SSF118370, 1 hit
PROSITEiView protein in PROSITE
PS50229 WH1, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q9UI08-1) [UniParc]FASTAAdd to basket
Also known as: EVL-I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEQSICQAR ASVMVYDDTS KKWVPIKPGQ QGFSRINIYH NTASNTFRVV
60 70 80 90 100
GVKLQDQQVV INYSIVKGLK YNQATPTFHQ WRDARQVYGL NFASKEEATT
110 120 130 140 150
FSNAMLFALN IMNSQEGGPS SQRQVQNGPS PDEMDIQRRQ VMEQHQQQRQ
160 170 180 190 200
ESLERRTSAT GPILPPGHPS SAASAPVSCS GPPPPPPPPV PPPPTGATPP
210 220 230 240 250
PPPPLPAGGA QGSSHDESSM SGLAAAIAGA KLRRVQRPED ASGGSSPSGT
260 270 280 290 300
SKSDANRASS GGGGGGLMEE MNKLLAKRRK AASQSDKPAE KKEDESQMED
310 320 330 340 350
PSTSPSPGTR AASQPPNSSE AGRKPWERSN SVEKPVSSIL SRTPSVAKSP
360 370 380 390 400
EAKSPLQSQP HSRMKPAGSV NDMALDAFDL DRMKQEILEE VVRELHKVKE
410
EIIDAIRQEL SGISTT
Length:416
Mass (Da):44,620
Last modified:November 15, 2002 - v2
Checksum:iAD5B67458755D659
GO
Isoform 1 (identifier: Q9UI08-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAT

Show »
Length:418
Mass (Da):44,792
Checksum:iBFCCF68CF923720C
GO
Isoform 3 (identifier: Q9UI08-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFAFEEF
     364-416: MKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT → YRTTLLLTCPPGFGAPLSPVP

Note: No experimental confirmation available.
Show »
Length:390
Mass (Da):41,577
Checksum:iF2E44B1B78751A0F
GO
Isoform 4 (identifier: Q9UI08-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     368-397: Missing.

Show »
Length:386
Mass (Da):41,136
Checksum:i13FE2387BF9C4F3C
GO
Isoform 5 (identifier: Q9UI08-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAT
     342-362: Missing.

Show »
Length:397
Mass (Da):42,578
Checksum:i738CD949799827C0
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YJN0H0YJN0_HUMAN
Ena/VASP-like protein
EVL
212Annotation score:
G3V3G2G3V3G2_HUMAN
Ena/VASP-like protein
EVL
121Annotation score:
G3V2K5G3V2K5_HUMAN
Ena/VASP-like protein
EVL
115Annotation score:
G3V5F7G3V5F7_HUMAN
Ena/VASP-like protein
EVL
168Annotation score:
G3V535G3V535_HUMAN
Ena/VASP-like protein
EVL
124Annotation score:
G3V314G3V314_HUMAN
Ena/VASP-like protein
EVL
215Annotation score:
H0YJL6H0YJL6_HUMAN
Ena/VASP-like protein
EVL
104Annotation score:
A0A087WYI2A0A087WYI2_HUMAN
Ena/VASP-like protein
EVL
283Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti201P → S in AAF17197 (PubMed:10931946).Curated1
Sequence conflicti329S → N in AAP97156 (Ref. 2) Curated1
Sequence conflicti364M → Y in CAB63763 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036464188P → L in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs367737727Ensembl.1
Natural variantiVAR_036465247P → L in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0040441M → MAT in isoform 1 and isoform 5. 4 Publications1
Alternative sequenceiVSP_0573221M → MFAFEEF in isoform 3. 1 Publication1
Alternative sequenceiVSP_058778342 – 362Missing in isoform 5. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_057323364 – 416MKPAG…GISTT → YRTTLLLTCPPGFGAPLSPV P in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_058779368 – 397Missing in isoform 4. Add BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF052504 mRNA Translation: AAF21709.1
AF087843 mRNA Translation: AAP97156.1
AF112209 mRNA Translation: AAF17197.1
AK289720 mRNA Translation: BAF82409.1
AK295919 mRNA Translation: BAH12221.1
AL133368 Genomic DNA No translation available.
AL133523 Genomic DNA No translation available.
AL157912 Genomic DNA No translation available.
KF456005 Genomic DNA No translation available.
KF456007 Genomic DNA No translation available.
KF456010 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81684.1
BC023997 mRNA Translation: AAH23997.1
BC032358 mRNA Translation: AAH32358.1
AF131766 mRNA Translation: AAD20040.1
AL133642 mRNA Translation: CAB63763.2
CCDSiCCDS81851.1 [Q9UI08-1]
CCDS9955.1 [Q9UI08-2]
RefSeqiNP_001317150.1, NM_001330221.1 [Q9UI08-1]
NP_057421.1, NM_016337.2 [Q9UI08-2]
UniGeneiHs.125867

Genome annotation databases

EnsembliENST00000392920; ENSP00000376652; ENSG00000196405 [Q9UI08-2]
ENST00000402714; ENSP00000384720; ENSG00000196405 [Q9UI08-1]
ENST00000544450; ENSP00000437904; ENSG00000196405 [Q9UI08-3]
GeneIDi51466
KEGGihsa:51466
UCSCiuc001ygt.4 human [Q9UI08-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF052504 mRNA Translation: AAF21709.1
AF087843 mRNA Translation: AAP97156.1
AF112209 mRNA Translation: AAF17197.1
AK289720 mRNA Translation: BAF82409.1
AK295919 mRNA Translation: BAH12221.1
AL133368 Genomic DNA No translation available.
AL133523 Genomic DNA No translation available.
AL157912 Genomic DNA No translation available.
KF456005 Genomic DNA No translation available.
KF456007 Genomic DNA No translation available.
KF456010 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81684.1
BC023997 mRNA Translation: AAH23997.1
BC032358 mRNA Translation: AAH32358.1
AF131766 mRNA Translation: AAD20040.1
AL133642 mRNA Translation: CAB63763.2
CCDSiCCDS81851.1 [Q9UI08-1]
CCDS9955.1 [Q9UI08-2]
RefSeqiNP_001317150.1, NM_001330221.1 [Q9UI08-1]
NP_057421.1, NM_016337.2 [Q9UI08-2]
UniGeneiHs.125867

3D structure databases

ProteinModelPortaliQ9UI08
SMRiQ9UI08
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119556, 45 interactors
ELMiQ9UI08
IntActiQ9UI08, 17 interactors
MINTiQ9UI08
STRINGi9606.ENSP00000376652

PTM databases

iPTMnetiQ9UI08
PhosphoSitePlusiQ9UI08

Polymorphism and mutation databases

BioMutaiEVL
DMDMi25090276

Proteomic databases

EPDiQ9UI08
PaxDbiQ9UI08
PeptideAtlasiQ9UI08
PRIDEiQ9UI08
ProteomicsDBi84445
84446 [Q9UI08-2]

Protocols and materials databases

DNASUi51466
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392920; ENSP00000376652; ENSG00000196405 [Q9UI08-2]
ENST00000402714; ENSP00000384720; ENSG00000196405 [Q9UI08-1]
ENST00000544450; ENSP00000437904; ENSG00000196405 [Q9UI08-3]
GeneIDi51466
KEGGihsa:51466
UCSCiuc001ygt.4 human [Q9UI08-1]

Organism-specific databases

CTDi51466
DisGeNETi51466
EuPathDBiHostDB:ENSG00000196405.12
GeneCardsiEVL
H-InvDBiHIX0011964
HGNCiHGNC:20234 EVL
HPAiCAB033987
HPA018849
HPA019536
neXtProtiNX_Q9UI08
OpenTargetsiENSG00000196405
PharmGKBiPA134890866
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQ1Z Eukaryota
ENOG410YM7V LUCA
GeneTreeiENSGT00730000110272
HOGENOMiHOG000013015
HOVERGENiHBG006655
InParanoidiQ9UI08
OMAiESQMEDP
OrthoDBiEOG091G0QTE
PhylomeDBiQ9UI08
TreeFamiTF321411

Enzyme and pathway databases

ReactomeiR-HSA-202433 Generation of second messenger molecules
R-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins
SignaLinkiQ9UI08

Miscellaneous databases

ChiTaRSiEVL human
GeneWikiiEnah/Vasp-like
GenomeRNAii51466
PROiPR:Q9UI08

Gene expression databases

BgeeiENSG00000196405 Expressed in 222 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_EVL
ExpressionAtlasiQ9UI08 baseline and differential
GenevisibleiQ9UI08 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR034319 ENA/VASP-like_protein
IPR011993 PH-like_dom_sf
IPR017354 VASP/EVL
IPR038023 VASP_sf
IPR014885 VASP_tetra
IPR000697 WH1/EVH1_dom
PANTHERiPTHR11202:SF4 PTHR11202:SF4, 1 hit
PfamiView protein in Pfam
PF08776 VASP_tetra, 1 hit
PF00568 WH1, 1 hit
PIRSFiPIRSF038010 Vasodilator_Phospo, 1 hit
SMARTiView protein in SMART
SM00461 WH1, 1 hit
SUPFAMiSSF118370 SSF118370, 1 hit
PROSITEiView protein in PROSITE
PS50229 WH1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiEVL_HUMAN
AccessioniPrimary (citable) accession number: Q9UI08
Secondary accession number(s): A8K105
, B7Z3I5, O95884, Q7Z522, Q8TBV1, Q9UF25, Q9UIC2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: November 15, 2002
Last modified: November 7, 2018
This is version 172 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again