Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UHW5 (GPN3_HUMAN)

Entry version 147 (02 Dec 2020)
Sequence version 2 (11 Sep 2007)
Previous versions | rss
Add a publicationFeedback
Protein

GPN-loop GTPase 3

Gene

GPN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Small GTPase required for proper localization of RNA polymerase II (RNAPII). May act at an RNAP assembly step prior to nuclear import.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei74Stabilizes the phosphate intermediate; shared with dimeric partnerBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi13 – 18GTPBy similarity6
Nucleotide bindingi174 – 177GTPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activity Source: GO_Central
  • GTP binding Source: UniProtKB-KW
Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UHW5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GPN-loop GTPase 31 Publication
Alternative name(s):
ATP-binding domain 1 family member C
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GPN31 PublicationImported
Synonyms:ATPBD1C
ORF Names:AD-009, UNQ1876/PRO4319
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000111231.8

Human Gene Nomenclature Database

More...HGNCi		HGNC:30186, GPN3

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UHW5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		51184

Open Targets

More...OpenTargetsi		ENSG00000111231

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162390164

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UHW5, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GPN3

Domain mapping of disease mutations (DMDM)

More...DMDMi		158564000

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003047901 – 284GPN-loop GTPase 3Add BLAST284

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UHW5

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UHW5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UHW5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UHW5

PeptideAtlas

More...PeptideAtlasi		Q9UHW5

PRoteomics IDEntifications database

More...PRIDEi		Q9UHW5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		27390
84420 [Q9UHW5-1]
84421 [Q9UHW5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UHW5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UHW5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000111231, Expressed in biceps brachii and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UHW5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UHW5, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000111231, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with GPN1 (PubMed:21768307). Binds to RNA polymerase II (RNAPII) (PubMed:20864038, PubMed:21768307).

Interacts directly with subunits RPB4 and RPB7 and the CTD of RPB1 (PubMed:21768307).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119359, 77 interactors

Protein interaction database and analysis system

More...IntActi		Q9UHW5, 62 interactors

Molecular INTeraction database

More...MINTi		Q9UHW5

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000442770

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UHW5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UHW5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi72 – 74Gly-Pro-Asn (GPN)-loop; involved in dimer interfaceBy similarity3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GPN-loop GTPase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1534, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183172

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_037460_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UHW5

Identification of Orthologs from Complete Genome Data

More...OMAi		MEDKYKF

Database of Orthologous Groups

More...OrthoDBi		964931at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UHW5

TreeFam database of animal gene trees

More...TreeFami		TF105810

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004130, Gpn
IPR030228, Gpn3
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...PANTHERi		PTHR21231, PTHR21231, 1 hit
PTHR21231:SF7, PTHR21231:SF7, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03029, ATP_bind_1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540, SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UHW5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRYAQLVMG PAGSGKSTYC ATMVQHCEAL NRSVQVVNLD PAAEHFNYSV 
        60         70         80         90        100
MADIRELIEV DDVMEDDSLR FGPNGGLVFC MEYFANNFDW LENCLGHVED 
       110        120        130        140        150
DYILFDCPGQ IELYTHLPVM KQLVQQLEQW EFRVCGVFLV DSQFMVESFK 
       160        170        180        190        200
FISGILAALS AMISLEIPQV NIMTKMDLLS KKAKKEIEKF LDPDMYSLLE 
       210        220        230        240        250
DSTSDLRSKK FKKLTKAICG LIDDYSMVRF LPYDQSDEES MNIVLQHIDF 
       260        270        280 
AIQYGEDLEF KEPKEREDES SSMFDEYFQE CQDE
Length:284
Mass (Da):32,761
Last modified:September 11, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8E604ECB5C1DE3B5
GO
Isoform 2 (identifier: Q9UHW5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-15: G → GKVRICGDKER

Show »
Length:294
Mass (Da):33,947
Checksum:i7B8E6579A6265240
GO
Isoform 3 (identifier: Q9UHW5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MPRYAQLVMGPAGSGK → MLPKTRGAFHFSIPDPQHICKSRGSPYRSNVCTQTTDRSTWRKDAELYLLSVITQ

Show »
Length:323
Mass (Da):37,438
Checksum:i8DC788F0AB8490A4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W1F4F8W1F4_HUMAN
GPN-loop GTPase 3
GPN3
159Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI19H0YI19_HUMAN
GPN-loop GTPase 3
GPN3
118Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHZ5H0YHZ5_HUMAN
GPN-loop GTPase 3
GPN3
120Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3M7S4R3M7_HUMAN
GPN-loop GTPase 3
GPN3
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD97937 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti6 – 7QL → HC in AAQ76821 (PubMed:16533400).Curated2
Sequence conflicti6 – 7QL → HC in AAF17210 (PubMed:10931946).Curated2
Sequence conflicti13 – 16GSGK → HAKR in AAQ76821 (PubMed:16533400).Curated4
Sequence conflicti13 – 16GSGK → HAKR in AAF17210 (PubMed:10931946).Curated4
Sequence conflicti122Q → H in AAQ89437 (PubMed:12975309).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03510752A → V1 PublicationCorresponds to variant dbSNP:rs17856906Ensembl.1
Natural variantiVAR_035108244V → A1 PublicationCorresponds to variant dbSNP:rs17850320Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0473271 – 16MPRYA…AGSGK → MLPKTRGAFHFSIPDPQHIC KSRGSPYRSNVCTQTTDRST WRKDAELYLLSVITQ in isoform 3. CuratedAdd BLAST16
Alternative sequenceiVSP_02812515G → GKVRICGDKER in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY364262 mRNA Translation: AAQ76821.1
AM992619 mRNA Translation: CAQ52399.1
AM992620 mRNA Translation: CAQ52400.1
AF117229 mRNA Translation: AAF17210.1
AY359078 mRNA Translation: AAQ89437.1
BX537973 mRNA Translation: CAD97937.1 Different initiation.
AK314946 mRNA Translation: BAG37451.1
AK223209 mRNA Translation: BAD96929.1
AC002350 Genomic DNA No translation available.
AC144548 Genomic DNA No translation available.
BC008416 mRNA Translation: AAH08416.1
BC031024 mRNA Translation: AAH31024.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53830.1 [Q9UHW5-2]
CCDS53831.1 [Q9UHW5-3]
CCDS9147.1 [Q9UHW5-1]

NCBI Reference Sequences

More...RefSeqi		NP_001157844.1, NM_001164372.1 [Q9UHW5-3]
NP_001157845.1, NM_001164373.1 [Q9UHW5-2]
NP_057385.3, NM_016301.3 [Q9UHW5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000228827; ENSP00000228827; ENSG00000111231 [Q9UHW5-1]
ENST00000537466; ENSP00000443068; ENSG00000111231 [Q9UHW5-2]
ENST00000543199; ENSP00000442770; ENSG00000111231 [Q9UHW5-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		51184

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:51184

UCSC genome browser

More...UCSCi		uc001tqr.4, human [Q9UHW5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY364262 mRNA Translation: AAQ76821.1
AM992619 mRNA Translation: CAQ52399.1
AM992620 mRNA Translation: CAQ52400.1
AF117229 mRNA Translation: AAF17210.1
AY359078 mRNA Translation: AAQ89437.1
BX537973 mRNA Translation: CAD97937.1 Different initiation.
AK314946 mRNA Translation: BAG37451.1
AK223209 mRNA Translation: BAD96929.1
AC002350 Genomic DNA No translation available.
AC144548 Genomic DNA No translation available.
BC008416 mRNA Translation: AAH08416.1
BC031024 mRNA Translation: AAH31024.1
CCDSiCCDS53830.1 [Q9UHW5-2]
CCDS53831.1 [Q9UHW5-3]
CCDS9147.1 [Q9UHW5-1]
RefSeqiNP_001157844.1, NM_001164372.1 [Q9UHW5-3]
NP_001157845.1, NM_001164373.1 [Q9UHW5-2]
NP_057385.3, NM_016301.3 [Q9UHW5-1]

3D structure databases

SMRiQ9UHW5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi119359, 77 interactors
IntActiQ9UHW5, 62 interactors
MINTiQ9UHW5
STRINGi9606.ENSP00000442770

PTM databases

iPTMnetiQ9UHW5
PhosphoSitePlusiQ9UHW5

Polymorphism and mutation databases

BioMutaiGPN3
DMDMi158564000

Proteomic databases

EPDiQ9UHW5
jPOSTiQ9UHW5
MassIVEiQ9UHW5
PaxDbiQ9UHW5
PeptideAtlasiQ9UHW5
PRIDEiQ9UHW5
ProteomicsDBi27390
84420 [Q9UHW5-1]
84421 [Q9UHW5-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31008, 55 antibodies

The DNASU plasmid repository

More...DNASUi		51184

Genome annotation databases

EnsembliENST00000228827; ENSP00000228827; ENSG00000111231 [Q9UHW5-1]
ENST00000537466; ENSP00000443068; ENSG00000111231 [Q9UHW5-2]
ENST00000543199; ENSP00000442770; ENSG00000111231 [Q9UHW5-3]
GeneIDi51184
KEGGihsa:51184
UCSCiuc001tqr.4, human [Q9UHW5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51184
DisGeNETi51184
EuPathDBiHostDB:ENSG00000111231.8

GeneCards: human genes, protein and diseases

More...GeneCardsi		GPN3
HGNCiHGNC:30186, GPN3
HPAiENSG00000111231, Low tissue specificity
neXtProtiNX_Q9UHW5
OpenTargetsiENSG00000111231
PharmGKBiPA162390164

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1534, Eukaryota
GeneTreeiENSGT00950000183172
HOGENOMiCLU_037460_0_0_1
InParanoidiQ9UHW5
OMAiMEDKYKF
OrthoDBi964931at2759
PhylomeDBiQ9UHW5
TreeFamiTF105810

Enzyme and pathway databases

PathwayCommonsiQ9UHW5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		51184, 674 hits in 855 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GPN3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		51184
PharosiQ9UHW5, Tdark

Protein Ontology

More...PROi		PR:Q9UHW5
RNActiQ9UHW5, protein

Gene expression databases

BgeeiENSG00000111231, Expressed in biceps brachii and 235 other tissues
ExpressionAtlasiQ9UHW5, baseline and differential
GenevisibleiQ9UHW5, HS

Family and domain databases

InterProiView protein in InterPro
IPR004130, Gpn
IPR030228, Gpn3
IPR027417, P-loop_NTPase
PANTHERiPTHR21231, PTHR21231, 1 hit
PTHR21231:SF7, PTHR21231:SF7, 1 hit
PfamiView protein in Pfam
PF03029, ATP_bind_1, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGPN3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UHW5
Secondary accession number(s): B2RC54
, D4YWV1, F5H759, Q53FS3, Q6UVZ6, Q7Z3D3, Q8NEI2, Q96HK9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: December 2, 2020
This is version 147 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again