UniProtKB - Q9UHV8 (PP13_HUMAN)

BLAST

>sp|Q9UHV8|PP13_HUMAN Galactoside-binding soluble lectin 13 OS=Homo sapiens OX=9606 GN=LGALS13 PE=1 SV=1
MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGN
HVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSF
VKMVQVSRDISLTSVCVCN

Align
Format
Add to basket Added to basket
History
Entry version 154 (12 Sep 2018)
Sequence version 1 (01 May 2000)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Galactoside-binding soluble lectin 13

Gene

LGALS13

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis (PubMed:10527825, PubMed:19497882). Has hemagglutinating activity towards chicken erythrocytes (PubMed:29343868).3 Publications

GO - Molecular functionⁱ

carbohydrate binding Source: UniProtKB-KW
lysophospholipase activity
Source: ProtInc
Traceable author statementⁱ
- 10527825

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

apoptotic process Source: UniProtKB-KW
phospholipid metabolic process
Source: ProtInc
Traceable author statementⁱ
- 10527825
positive regulation of T cell apoptotic process Source: InterPro

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Hemagglutinin
Biological process	Apoptosis
Ligand	Lectin

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Galactoside-binding soluble lectin 13 Alternative name(s): Galectin-13 Short name: Gal-13 Placental tissue protein 13 Short name: PP13 Short name: Placental protein 13
Gene namesⁱ	Name:LGALS13 Synonyms:PLAC8
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 19

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000105198.10
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:15449 LGALS13
MIMⁱ	608717 gene
neXtProtⁱ	NX_Q9UHV8

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	53	R → H: No effect on its haemagglutinating activity. 1 Publication	1
Mutagenesisⁱ	136	C → S: Loss of homodimerization; when associated with S-138. 1 Publication	1
Mutagenesisⁱ	138	C → S: Loss of homodimerization; when associated with S-136. 1 Publication	1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	29124
Open Targets More...OpenTargetsⁱ	ENSG00000105198
PharmGKBⁱ	PA134923011

Polymorphism and mutation databases

BioMutaⁱ	LGALS13
DMDMⁱ	41017510

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000076963	1 – 139	Galactoside-binding soluble lectin 13Add BLAST		139

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Disulfide bondⁱ	136	Interchain (with C-138)1 Publication
Disulfide bondⁱ	138	Interchain (with C-136)1 Publication

Keywords - PTMⁱ

Disulfide bond

Proteomic databases

PaxDbⁱ	Q9UHV8
PeptideAtlas More...PeptideAtlasⁱ	Q9UHV8
PRIDEⁱ	Q9UHV8
ProteomicsDBⁱ	84418

Expressionⁱ

Tissue specificityⁱ

Detected in adult and fetal spleen, fetal kidney, adult urinary bladder and placenta. Placental expression originates predominantly from the syncytiotrophoblast.2 Publications

Gene expression databases

Bgeeⁱ	ENSG00000105198 Expressed in 28 organ(s), highest expression level in chorionic villus
CleanExⁱ	HS_LGALS13 HS_PLAC8
ExpressionAtlasⁱ	Q9UHV8 baseline and differential
Genevisibleⁱ	Q9UHV8 HS

Interactionⁱ

Subunit structureⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
HOXA1	P49639	5	EBI-3957707,EBI-740785
Hoxa1	P09022	3	EBI-3957707,EBI-3957603	From Mus musculus.
NUFIP2	Q7Z417	3	EBI-3957707,EBI-1210753
PACSIN3	Q9UKS6	3	EBI-3957707,EBI-77926

Protein-protein interaction databases

BioGridⁱ	118889, 11 interactors
IntActⁱ	Q9UHV8, 8 interactors
Molecular INTeraction database More...MINTⁱ	Q9UHV8
STRINGⁱ	9606.ENSP00000221797

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	6 – 11	Combined sources	6
Beta strandⁱ	19 – 28	Combined sources	10
Helixⁱ	30 – 32	Combined sources	3
Beta strandⁱ	35 – 45	Combined sources	11
Beta strandⁱ	50 – 57	Combined sources	8
Turnⁱ	58 – 60	Combined sources	3
Beta strandⁱ	61 – 68	Combined sources	8
Beta strandⁱ	76 – 79	Combined sources	4
Beta strandⁱ	89 – 95	Combined sources	7
Beta strandⁱ	97 – 104	Combined sources	8
Beta strandⁱ	107 – 113	Combined sources	7
Helixⁱ	118 – 120	Combined sources	3
Beta strandⁱ	123 – 138	Combined sources	16

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9UHV8
SMRⁱ	Q9UHV8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	6 – 138	GalectinPROSITE-ProRule annotationAdd BLAST		133

Phylogenomic databases

eggNOGⁱ	KOG3587 Eukaryota ENOG4111EA0 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000064497
HOGENOMⁱ	HOG000015090
HOVERGENⁱ	HBG006255
InParanoidⁱ	Q9UHV8
KEGG Orthology (KO) More...KOⁱ	K10096
PhylomeDBⁱ	Q9UHV8
TreeFamⁱ	TF315551

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00070 GLECT, 1 hit
InterProⁱ	View protein in InterPro IPR013320 ConA-like_dom_sf IPR030653 Galectin_13 IPR001079 Galectin_CRD
PANTHERⁱ	PTHR11346:SF120 PTHR11346:SF120, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00337 Gal-bind_lectin, 1 hit
SMARTⁱ	View protein in SMART SM00908 Gal-bind_lectin, 1 hit SM00276 GLECT, 1 hit
SUPFAMⁱ	SSF49899 SSF49899, 1 hit
PROSITEⁱ	View protein in PROSITE PS51304 GALECTIN, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

Q9UHV8-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSSLPVPYKL PVSLSVGSCV IIKGTPIHSF INDPQLQVDF YTDMDEDSDI 
        60         70         80         90        100
AFRFRVHFGN HVVMNRREFG IWMLEETTDY VPFEDGKQFE LCIYVHYNEY 
       110        120        130 
EIKVNGIRIY GFVHRIPPSF VKMVQVSRDI SLTSVCVCN

Length:139

Mass (Da):16,119

Last modified:May 1, 2000 - v1

Checksum:ⁱD1FE26D66C1F5FD0

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A087X0J5	A0A087X0J5_HUMAN	Galectin Galectin	LGALS13	141	Annotation score:
M0R015	M0R015_HUMAN	Galectin Galectin	LGALS13	83	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF117383 mRNA Translation: AAF22001.1 AY055826 mRNA Translation: AAL09162.1 FJ613336 mRNA Translation: ACR09638.1 FJ613337 mRNA Translation: ACR09639.1 FJ613338 mRNA Translation: ACR09640.1 CH471126 Genomic DNA Translation: EAW56910.1 BC066304 mRNA Translation: AAH66304.1 BC069312 mRNA Translation: AAH69312.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS33024.1
NCBI Reference Sequences More...RefSeqⁱ	NP_037400.1, NM_013268.2
UniGeneⁱ	Hs.23671

Genome annotation databases

Ensemblⁱ	ENST00000221797; ENSP00000221797; ENSG00000105198
GeneIDⁱ	29124
KEGGⁱ	hsa:29124
UCSC genome browser More...UCSCⁱ	uc002omb.4 human

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9UHV8	Galectin (Fragment)		HUMAN		70	UniRef90_Q9UHV8
UPI0005F4D998		CERAT		148
UPI00083C0BD0		RHIBE		177
UPI000CCFCAC2		HUMAN		142
UPI000CCFCAE9		HUMAN		142
+1

Protein	Similar proteins		Species	Score	Length	Source
Q9UHV8	Galectin-10	)	HUMAN		142	UniRef50_Q05315
Galectin		CALJA		139
Galectin		Cebus capucinus imitator		135
Galectin		CHLSB		145
Galectin		SAIBB		142
+110

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF117383 mRNA Translation: AAF22001.1 AY055826 mRNA Translation: AAL09162.1 FJ613336 mRNA Translation: ACR09638.1 FJ613337 mRNA Translation: ACR09639.1 FJ613338 mRNA Translation: ACR09640.1 CH471126 Genomic DNA Translation: EAW56910.1 BC066304 mRNA Translation: AAH66304.1 BC069312 mRNA Translation: AAH69312.1
CCDSⁱ	CCDS33024.1
RefSeqⁱ	NP_037400.1, NM_013268.2
UniGeneⁱ	Hs.23671

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1F87	model	-	A	1-139	[»]
	5XG7	X-ray	1.55	A	1-139	[»]
	5XG8	X-ray	1.55	A	2-139	[»]
	5Y03	X-ray	2.12	A	1-139	[»]
ProteinModelPortalⁱ	Q9UHV8
SMRⁱ	Q9UHV8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	118889, 11 interactors
IntActⁱ	Q9UHV8, 8 interactors
MINTⁱ	Q9UHV8
STRINGⁱ	9606.ENSP00000221797

Polymorphism and mutation databases

BioMutaⁱ	LGALS13
DMDMⁱ	41017510

Proteomic databases

PaxDbⁱ	Q9UHV8
PeptideAtlasⁱ	Q9UHV8
PRIDEⁱ	Q9UHV8
ProteomicsDBⁱ	84418

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	29124
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000221797; ENSP00000221797; ENSG00000105198
GeneIDⁱ	29124
KEGGⁱ	hsa:29124
UCSCⁱ	uc002omb.4 human

Organism-specific databases

CTDⁱ	29124
DisGeNETⁱ	29124
EuPathDBⁱ	HostDB:ENSG00000105198.10
GeneCardsⁱ	LGALS13
HGNCⁱ	HGNC:15449 LGALS13
MIMⁱ	608717 gene
neXtProtⁱ	NX_Q9UHV8
OpenTargetsⁱ	ENSG00000105198
PharmGKBⁱ	PA134923011
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3587 Eukaryota ENOG4111EA0 LUCA
GeneTreeⁱ	ENSGT00530000064497
HOGENOMⁱ	HOG000015090
HOVERGENⁱ	HBG006255
InParanoidⁱ	Q9UHV8
KOⁱ	K10096
PhylomeDBⁱ	Q9UHV8
TreeFamⁱ	TF315551

Miscellaneous databases

GeneWikiⁱ	LGALS13
GenomeRNAiⁱ	29124
Protein Ontology More...PROⁱ	PR:Q9UHV8
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000105198 Expressed in 28 organ(s), highest expression level in chorionic villus
CleanExⁱ	HS_LGALS13 HS_PLAC8
ExpressionAtlasⁱ	Q9UHV8 baseline and differential
Genevisibleⁱ	Q9UHV8 HS

Family and domain databases

CDDⁱ	cd00070 GLECT, 1 hit
InterProⁱ	View protein in InterPro IPR013320 ConA-like_dom_sf IPR030653 Galectin_13 IPR001079 Galectin_CRD
PANTHERⁱ	PTHR11346:SF120 PTHR11346:SF120, 1 hit
Pfamⁱ	View protein in Pfam PF00337 Gal-bind_lectin, 1 hit
SMARTⁱ	View protein in SMART SM00908 Gal-bind_lectin, 1 hit SM00276 GLECT, 1 hit
SUPFAMⁱ	SSF49899 SSF49899, 1 hit
PROSITEⁱ	View protein in PROSITE PS51304 GALECTIN, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PP13_HUMAN
Accessionⁱ	Q9UHV8Primary (citable) accession number: Q9UHV8 Secondary accession number(s): C5HZ15
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	January 16, 2004
	Last sequence update:	May 1, 2000
	Last modified:	September 12, 2018
	This is version 154 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 19
Human chromosome 19: entries, gene names and cross-references to MIM
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9UHV8 (PP13_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Galactoside-binding soluble lectin 13

LGALS13

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ