UniProtKB - Q9UHV8 (PP13_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|Q9UHV8|PP13_HUMAN Galactoside-binding soluble lectin 13 OS=Homo sapiens OX=9606 GN=LGALS13 PE=1 SV=1 MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGN HVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSF VKMVQVSRDISLTSVCVCN
- Align
Galactoside-binding soluble lectin 13
LGALS13
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"Isolation and sequence analysis of a cDNA encoding human placental tissue protein 13 (PP13), a new lysophospholipase, homologue of human eosinophil Charcot-Leyden crystal protein."
Than N.G., Sumegi B., Than G.N., Berente Z., Bohn H.
Placenta 20:703-710(1999) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, TISSUE SPECIFICITY. - Ref.3"A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death."
Than N.G., Romero R., Goodman M., Weckle A., Xing J., Dong Z., Xu Y., Tarquini F., Szilagyi A., Gal P., Hou Z., Tarca A.L., Kim C.J., Kim J.S., Haidarian S., Uddin M., Bohn H., Benirschke K. , Santolaya-Forgas J., Grossman L.I., Erez O., Hassan S.S., Zavodszky P., Papp Z., Wildman D.E.
Proc. Natl. Acad. Sci. U.S.A. 106:9731-9736(2009) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, TISSUE SPECIFICITY. - Ref.8"Galectin-13, a different prototype galectin, does not bind beta-galacto-sides and forms dimers via intermolecular disulfide bridges between Cys-136 and Cys-138."
Su J., Wang Y., Si Y., Gao J., Song C., Cui L., Wu R., Tai G., Zhou Y.
Sci. Rep. 8:980-980(2018) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 2-139 OF WILD TYPE AND MUTANT HIS-53, FUNCTION, DISULFIDE BOND, SUBUNIT, SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-53; CYS-136 AND CYS-138.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- carbohydrate binding Source: UniProtKB-KW
- lysophospholipase activity Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- apoptotic process Source: UniProtKB-KW
- phospholipid metabolic process Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- positive regulation of T cell apoptotic process Source: InterPro
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Hemagglutinin |
| Biological process | Apoptosis |
| Ligand | Lectin |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Galactoside-binding soluble lectin 13Alternative name(s): Galectin-13 Short name: Gal-13 Placental tissue protein 13 Short name: PP13 Short name: Placental protein 13 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:LGALS13 Synonyms:PLAC8 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000105198.10 |
Human Gene Nomenclature Database More...HGNCi | HGNC:15449 LGALS13 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 608717 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q9UHV8 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Nucleus
- Nucleus matrix 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Galectin-13, a different prototype galectin, does not bind beta-galacto-sides and forms dimers via intermolecular disulfide bridges between Cys-136 and Cys-138."
Su J., Wang Y., Si Y., Gao J., Song C., Cui L., Wu R., Tai G., Zhou Y.
Sci. Rep. 8:980-980(2018) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 2-139 OF WILD TYPE AND MUTANT HIS-53, FUNCTION, DISULFIDE BOND, SUBUNIT, SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-53; CYS-136 AND CYS-138.
- Nucleus matrix 1 Publication
Other locations
- Cytoplasm 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Galectin-13, a different prototype galectin, does not bind beta-galacto-sides and forms dimers via intermolecular disulfide bridges between Cys-136 and Cys-138."
Su J., Wang Y., Si Y., Gao J., Song C., Cui L., Wu R., Tai G., Zhou Y.
Sci. Rep. 8:980-980(2018) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 2-139 OF WILD TYPE AND MUTANT HIS-53, FUNCTION, DISULFIDE BOND, SUBUNIT, SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-53; CYS-136 AND CYS-138.
- Cytoplasm 1 Publication
Nucleus
- nuclear matrix Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Other locations
- cytoplasm Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Cytoplasm, Nucleus<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 53 | R → H: No effect on its haemagglutinating activity. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 136 | C → S: Loss of homodimerization; when associated with S-138. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 138 | C → S: Loss of homodimerization; when associated with S-136. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Organism-specific databases
DisGeNET More...DisGeNETi | 29124 |
Open Targets More...OpenTargetsi | ENSG00000105198 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA134923011 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | LGALS13 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 41017510 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000076963 | 1 – 139 | Galactoside-binding soluble lectin 13Add BLAST | 139 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 136 | Interchain (with C-138)1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| ||
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 138 | Interchain (with C-136)1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
|
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Disulfide bondProteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q9UHV8 |
PeptideAtlas More...PeptideAtlasi | Q9UHV8 |
PRoteomics IDEntifications database More...PRIDEi | Q9UHV8 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 84418 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"Isolation and sequence analysis of a cDNA encoding human placental tissue protein 13 (PP13), a new lysophospholipase, homologue of human eosinophil Charcot-Leyden crystal protein."
Than N.G., Sumegi B., Than G.N., Berente Z., Bohn H.
Placenta 20:703-710(1999) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, TISSUE SPECIFICITY. - Ref.3"A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death."
Than N.G., Romero R., Goodman M., Weckle A., Xing J., Dong Z., Xu Y., Tarquini F., Szilagyi A., Gal P., Hou Z., Tarca A.L., Kim C.J., Kim J.S., Haidarian S., Uddin M., Bohn H., Benirschke K. , Santolaya-Forgas J., Grossman L.I., Erez O., Hassan S.S., Zavodszky P., Papp Z., Wildman D.E.
Proc. Natl. Acad. Sci. U.S.A. 106:9731-9736(2009) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, TISSUE SPECIFICITY.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000105198 |
CleanEx database of gene expression profiles More...CleanExi | HS_LGALS13 HS_PLAC8 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q9UHV8 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q9UHV8 HS |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.6"Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17)."
Bohn H., Kraus W., Winckler W.
Oncodev. Biol. Med. 4:343-350(1983) [PubMed] [Europe PMC] [Abstract]Cited for: SUBUNIT. - Ref.8"Galectin-13, a different prototype galectin, does not bind beta-galacto-sides and forms dimers via intermolecular disulfide bridges between Cys-136 and Cys-138."
Su J., Wang Y., Si Y., Gao J., Song C., Cui L., Wu R., Tai G., Zhou Y.
Sci. Rep. 8:980-980(2018) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 2-139 OF WILD TYPE AND MUTANT HIS-53, FUNCTION, DISULFIDE BOND, SUBUNIT, SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-53; CYS-136 AND CYS-138.
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HOXA1 | P49639 | 5 | EBI-3957707,EBI-740785 | |
| Hoxa1 | P09022 | 3 | EBI-3957707,EBI-3957603 | From Mus musculus. |
| NUFIP2 | Q7Z417 | 3 | EBI-3957707,EBI-1210753 | |
| PACSIN3 | Q9UKS6 | 3 | EBI-3957707,EBI-77926 |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 118889, 11 interactors |
Protein interaction database and analysis system More...IntActi | Q9UHV8, 8 interactors |
Molecular INTeraction database More...MINTi | Q9UHV8 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000221797 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 6 – 11 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 19 – 28 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 30 – 32 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 35 – 45 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 11 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 50 – 57 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 58 – 60 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 61 – 68 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 76 – 79 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 89 – 95 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 97 – 104 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 107 – 113 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 118 – 120 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 123 – 138 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 16 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q9UHV8 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q9UHV8 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 6 – 138 | GalectinPROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Add BLAST | 133 |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG3587 Eukaryota ENOG4111EA0 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00530000064497 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000015090 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG006255 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q9UHV8 |
KEGG Orthology (KO) More...KOi | K10096 |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q9UHV8 |
TreeFam database of animal gene trees More...TreeFami | TF315551 |
Family and domain databases
Conserved Domains Database More...CDDi | cd00070 GLECT, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR013320 ConA-like_dom_sf IPR030653 Galectin_13 IPR001079 Galectin_CRD |
The PANTHER Classification System More...PANTHERi | PTHR11346:SF120 PTHR11346:SF120, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00337 Gal-bind_lectin, 1 hit |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00908 Gal-bind_lectin, 1 hit SM00276 GLECT, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF49899 SSF49899, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51304 GALECTIN, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
10 20 30 40 50
MSSLPVPYKL PVSLSVGSCV IIKGTPIHSF INDPQLQVDF YTDMDEDSDI
60 70 80 90 100
AFRFRVHFGN HVVMNRREFG IWMLEETTDY VPFEDGKQFE LCIYVHYNEY
110 120 130
EIKVNGIRIY GFVHRIPPSF VKMVQVSRDI SLTSVCVCN
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AF117383 mRNA Translation: AAF22001.1 AY055826 mRNA Translation: AAL09162.1 FJ613336 mRNA Translation: ACR09638.1 FJ613337 mRNA Translation: ACR09639.1 FJ613338 mRNA Translation: ACR09640.1 CH471126 Genomic DNA Translation: EAW56910.1 BC066304 mRNA Translation: AAH66304.1 BC069312 mRNA Translation: AAH69312.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS33024.1 |
NCBI Reference Sequences More...RefSeqi | NP_037400.1, NM_013268.2 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.23671 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000221797; ENSP00000221797; ENSG00000105198 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 29124 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:29124 |
UCSC genome browser More...UCSCi | uc002omb.4 human |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q9UHV8 | UPI000CCFCAC2 | 142 | |||
| UPI0005F4D998 | 148 | ||||
| UPI00083C0BD0 | 177 | ||||
| UPI000CCFCAE9 | 142 | ||||
| UPI000CCFCAD5 | 138 | ||||
| +1 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q9UHV8 | UPI000CCFCAC2 | 142 | |||
| UPI0005F4D998 | 148 | ||||
| UPI00083C0BD0 | 177 | ||||
| UPI00080A4AA5 | 213 | ||||
| UPI0002656482 | 210 | ||||
| +4 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AF117383 mRNA Translation: AAF22001.1 AY055826 mRNA Translation: AAL09162.1 FJ613336 mRNA Translation: ACR09638.1 FJ613337 mRNA Translation: ACR09639.1 FJ613338 mRNA Translation: ACR09640.1 CH471126 Genomic DNA Translation: EAW56910.1 BC066304 mRNA Translation: AAH66304.1 BC069312 mRNA Translation: AAH69312.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS33024.1 |
NCBI Reference Sequences More...RefSeqi | NP_037400.1, NM_013268.2 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.23671 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1F87 | model | - | A | 1-139 | [»] | |
| 5XG7 | X-ray | 1.55 | A | 1-139 | [»] | |
| 5XG8 | X-ray | 1.55 | A | 2-139 | [»] | |
| 5Y03 | X-ray | 2.12 | A | 1-139 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q9UHV8 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q9UHV8 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 118889, 11 interactors |
Protein interaction database and analysis system More...IntActi | Q9UHV8, 8 interactors |
Molecular INTeraction database More...MINTi | Q9UHV8 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000221797 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | LGALS13 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 41017510 |
Proteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q9UHV8 |
PeptideAtlas More...PeptideAtlasi | Q9UHV8 |
PRoteomics IDEntifications database More...PRIDEi | Q9UHV8 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 84418 |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 29124 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000221797; ENSP00000221797; ENSG00000105198 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 29124 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:29124 |
UCSC genome browser More...UCSCi | uc002omb.4 human |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 29124 |
DisGeNET More...DisGeNETi | 29124 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000105198.10 |
GeneCards: human genes, protein and diseases More...GeneCardsi | LGALS13 |
Human Gene Nomenclature Database More...HGNCi | HGNC:15449 LGALS13 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 608717 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q9UHV8 |
Open Targets More...OpenTargetsi | ENSG00000105198 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA134923011 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG3587 Eukaryota ENOG4111EA0 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00530000064497 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000015090 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG006255 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q9UHV8 |
KEGG Orthology (KO) More...KOi | K10096 |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q9UHV8 |
TreeFam database of animal gene trees More...TreeFami | TF315551 |
Miscellaneous databases
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | LGALS13 |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 29124 |
Protein Ontology More...PROi | PR:Q9UHV8 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000105198 |
CleanEx database of gene expression profiles More...CleanExi | HS_LGALS13 HS_PLAC8 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q9UHV8 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q9UHV8 HS |
Family and domain databases
Conserved Domains Database More...CDDi | cd00070 GLECT, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR013320 ConA-like_dom_sf IPR030653 Galectin_13 IPR001079 Galectin_CRD |
The PANTHER Classification System More...PANTHERi | PTHR11346:SF120 PTHR11346:SF120, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00337 Gal-bind_lectin, 1 hit |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00908 Gal-bind_lectin, 1 hit SM00276 GLECT, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF49899 SSF49899, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51304 GALECTIN, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | PP13_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q9UHV8Primary (citable) accession number: Q9UHV8 Secondary accession number(s): C5HZ15 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | January 16, 2004 |
| Last sequence update: | May 1, 2000 | |
| Last modified: | July 18, 2018 | |
| This is version 153 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Reference proteomeDocuments
- Human chromosome 19
Human chromosome 19: entries, gene names and cross-references to MIM - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references
