Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9UHP3 (UBP25_HUMAN)

Entry version 197 (29 Sep 2021)
Sequence version 4 (10 Aug 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Ubiquitin carboxyl-terminal hydrolase 25

Gene

USP25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Deubiquitinating enzyme that hydrolyzes ubiquitin moieties conjugated to substrates and thus, functions to process newly synthesized Ubiquitin, to recycle ubiquitin molecules or to edit polyubiquitin chains and prevents proteasomal degradation of substrates. Hydrolyzes both 'Lys-48'- and 'Lys-63'-linked tetraubiquitin chains.

The muscle-specific isoform (USP25m) may have a role in the regulation of muscular differentiation and function.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal). EC:3.4.19.12

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1781 Publication1
Active sitei599By similarity1
Active sitei607By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processUbl conjugation pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UHP3

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5689880, Ub-specific processing proteases

Protein family/group databases

MEROPS protease database

More...MEROPSi		C19.041

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin carboxyl-terminal hydrolase 25 (EC:3.4.19.12)
Alternative name(s):
Deubiquitinating enzyme 25
USP on chromosome 21
Ubiquitin thioesterase 25
Ubiquitin-specific-processing protease 25
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:USP25
Synonyms:USP21
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12624, USP25

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604736, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UHP3

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000155313

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi91V → A: No interaction with SUMO3; when associated with A-92. 1 Publication1
Mutagenesisi92I → A: No interaction with SUMO3; when associated with A-91. 1 Publication1
Mutagenesisi99K → R: Abolishes sumoylation. Decreased enzymatic activity. 2 Publications1
Mutagenesisi178C → S: Abrogates deubiquitinating activity. No effect on homo- or oligomerization. 1 Publication1
Mutagenesisi740Y → F: No effect on interaction with SYK. 1 Publication1
Mutagenesisi878T → I: No effect on interaction with SYK. 1 Publication1
Mutagenesisi880Y → F: No effect on interaction with SYK. 1 Publication1
Mutagenesisi883I → S: No effect on interaction with SYK. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		29761

Open Targets

More...OpenTargetsi		ENSG00000155313

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37249

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UHP3, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4295975

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		USP25

Domain mapping of disease mutations (DMDM)

More...DMDMi		302393833

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000806531 – 1055Ubiquitin carboxyl-terminal hydrolase 25Add BLAST1055

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei85PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate1 Publication
Modified residuei740Phosphotyrosine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Acetylated.1 Publication
Sumoylation impairs binding to and hydrolysis of ubiquitin chains. Sumoylated preferentially with SUMO2 or SUMO3. Desumoylated by SENP1. Regulated by ubiquitination on the same residue.1 Publication
Preferentially monoubiquitinated but can also be polyubiquitinated. Autodeubiquitinated. Ubiquitination activates the enzymatic activity either by preventing sumoylation or by allowing novel interactions.1 Publication
Phosphorylation in the C-terminal by SYK regulates USP25 cellular levels.2 Publications

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UHP3

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UHP3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UHP3

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9UHP3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UHP3

PeptideAtlas

More...PeptideAtlasi		Q9UHP3

PRoteomics IDEntifications database

More...PRIDEi		Q9UHP3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		84385 [Q9UHP3-2]
84386 [Q9UHP3-1]
84387 [Q9UHP3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UHP3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UHP3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform USP25a is found in most adult and fetal tissues; expression is moderately high in testis, pancreas, kidney, skeletal muscle, liver, lung, placenta, brain, heart, but very low in peripheral blood, colon, small intestine, ovary, prostate, thymus and spleen. Isoform USP25b is found in all tissues except heart and skeletal muscle. Isoform USP25m is heart and skeletal muscle specific.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

The muscle-specific isoform (USP25m) is up-regulated during myocyte differentiation. Levels increase up to 100-fold towards completion of differentiation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000155313, Expressed in sperm and 240 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UHP3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UHP3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000155313, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer or oligomer.

Interacts with ACTA1 (via its C-terminus); the interaction occurs for all isoforms but is strongest for isoform USP25m in muscle differentiating cells.

Interacts (isoform USP25m only) with MYBPC1; the interaction prevents proteasomal degradation of MYBPC1.

Interacts (isoform USP25m only) with FLNC (via filament repeats 17-18, 20-21 and 24).

Interacts with GAPDH.

Interacts with SUMO3; the interaction sumoylates efficiently USP25.

Interacts with SUMO2; the interaction sumoylates efficiently USP25.

Interacts with SUMO1; the interaction only weakly sumoylates USP25.

Interacts with SYK; phosphorylates USP25 and regulates USP25 intracellular levels.

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		118895, 76 interactors

Protein interaction database and analysis system

More...IntActi		Q9UHP3, 38 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000383044

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9UHP3

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UHP3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11055
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q9UHP3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UHP3

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini14 – 57UBA-likeAdd BLAST44
Domaini97 – 116UIM 1PROSITE-ProRule annotationAdd BLAST20
Domaini123 – 140UIM 2PROSITE-ProRule annotationAdd BLAST18
Domaini169 – 657USPAdd BLAST489

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni77 – 102SUMO interaction domain (SIM)Add BLAST26
Regioni464 – 507DisorderedSequence analysisAdd BLAST44
Regioni727 – 749DisorderedSequence analysisAdd BLAST23

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili541 – 578Sequence analysisAdd BLAST38
Coiled coili684 – 717Sequence analysisAdd BLAST34

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi89 – 95Required for SUMO paralog-specific binding7

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi472 – 507Polar residuesSequence analysisAdd BLAST36

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C19 family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1863, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157962

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012188_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UHP3

Identification of Orthologs from Complete Genome Data

More...OMAi		KGFNEPP

Database of Orthologous Groups

More...OrthoDBi		194025at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UHP3

TreeFam database of animal gene trees

More...TreeFami		TF329035

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR038765, Papain-like_cys_pep_sf
IPR001394, Peptidase_C19_UCH
IPR009060, UBA-like_sf
IPR003903, UIM_dom
IPR018200, USP_CS
IPR028889, USP_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00443, UCH, 1 hit
PF02809, UIM, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00726, UIM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46934, SSF46934, 1 hit
SSF54001, SSF54001, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50330, UIM, 1 hit
PS00972, USP_1, 1 hit
PS00973, USP_2, 1 hit
PS50235, USP_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform USP25a (identifier: Q9UHP3-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTVEQNVLQQ SAAQKHQQTF LNQLREITGI NDTQILQQAL KDSNGNLELA 
        60         70         80         90        100
VAFLTAKNAK TPQQEETTYY QTALPGNDRY ISVGSQADTN VIDLTGDDKD 
       110        120        130        140        150
DLQRAIALSL AESNRAFRET GITDEEQAIS RVLEASIAEN KACLKRTPTE 
       160        170        180        190        200
VWRDSRNPYD RKRQDKAPVG LKNVGNTCWF SAVIQSLFNL LEFRRLVLNY 
       210        220        230        240        250
KPPSNAQDLP RNQKEHRNLP FMRELRYLFA LLVGTKRKYV DPSRAVEILK 
       260        270        280        290        300
DAFKSNDSQQ QDVSEFTHKL LDWLEDAFQM KAEEETDEEK PKNPMVELFY 
       310        320        330        340        350
GRFLAVGVLE GKKFENTEMF GQYPLQVNGF KDLHECLEAA MIEGEIESLH 
       360        370        380        390        400
SENSGKSGQE HWFTELPPVL TFELSRFEFN QALGRPEKIH NKLEFPQVLY 
       410        420        430        440        450
LDRYMHRNRE ITRIKREEIK RLKDYLTVLQ QRLERYLSYG SGPKRFPLVD 
       460        470        480        490        500
VLQYALEFAS SKPVCTSPVD DIDASSPPSG SIPSQTLPST TEQQGALSSE 
       510        520        530        540        550
LPSTSPSSVA AISSRSVIHK PFTQSRIPPD LPMHPAPRHI TEEELSVLES 
       560        570        580        590        600
CLHRWRTEIE NDTRDLQESI SRIHRTIELM YSDKSMIQVP YRLHAVLVHE 
       610        620        630        640        650
GQANAGHYWA YIFDHRESRW MKYNDIAVTK SSWEELVRDS FGGYRNASAY 
       660        670        680        690        700
CLMYINDKAQ FLIQEEFNKE TGQPLVGIET LPPDLRDFVE EDNQRFEKEL 
       710        720        730        740        750
EEWDAQLAQK ALQEKLLASQ KLRESETSVT TAQAAGDPEY LEQPSRSDFS 
       760        770        780        790        800
KHLKEETIQI ITKASHEHED KSPETVLQSA IKLEYARLVK LAQEDTPPET 
       810        820        830        840        850
DYRLHHVVVY FIQNQAPKKI IEKTLLEQFG DRNLSFDERC HNIMKVAQAK 
       860        870        880        890        900
LEMIKPEEVN LEEYEEWHQD YRKFRETTMY LIIGLENFQR ESYIDSLLFL 
       910        920        930        940        950
ICAYQNNKEL LSKGLYRGHD EELISHYRRE CLLKLNEQAA ELFESGEDRE 
       960        970        980        990       1000
VNNGLIIMNE FIVPFLPLLL VDEMEEKDIL AVEDMRNRWC SYLGQEMEPH 
      1010       1020       1030       1040       1050
LQEKLTDFLP KLLDCSMEIK SFHEPPKLPS YSTHELCERF ARIMLSLSRT 

PADGR
Length:1,055
Mass (Da):122,218
Last modified:August 10, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0B9CECDCAD619CF2
GO
Isoform USP25b (identifier: Q9UHP3-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     779-779: S → SIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK

Show »
Length:1,087
Mass (Da):125,750
Checksum:i8F852D91651B2C6E
GO
Isoform USP25m (identifier: Q9UHP3-3) [UniParc]FASTAAdd to basket
Also known as: Muscle-specific isoform

The sequence of this isoform differs from the canonical sequence as follows:
     779-779: S → SKPENTTSQPLSNQRVVEVAIPHVGKFMIESKEGGYDDEIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK

Show »
Length:1,125
Mass (Da):129,963
Checksum:i85236A294FFEFD60
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q96B65Q96B65_HUMAN
USP25 protein
USP25
450Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C253H7C253_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP25
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1T8H7C1T8_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP25
229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti544E → K in AAF32263 (PubMed:10644437).Curated1
Sequence conflicti544E → K in ACN76567 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039632779S → SIMMTPNMQGIIMAIGKSRS VYDRCGPEAGFFK in isoform USP25b. 1 Publication1
Alternative sequenceiVSP_039631779S → SKPENTTSQPLSNQRVVEVA IPHVGKFMIESKEGGYDDEI MMTPNMQGIIMAIGKSRSVY DRCGPEAGFFK in isoform USP25m. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF170562 mRNA Translation: AAF32263.1
AF134213 mRNA Translation: AAF24998.1
FJ763652 mRNA Translation: ACN76567.1
CH471079 Genomic DNA Translation: EAX10041.1
BC075792 mRNA Translation: AAH75792.1
AK022574 mRNA Translation: BAB14107.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33515.1 [Q9UHP3-2]
CCDS63336.1 [Q9UHP3-3]
CCDS63337.1 [Q9UHP3-1]

NCBI Reference Sequences

More...RefSeqi		NP_001269970.1, NM_001283041.1 [Q9UHP3-3]
NP_001269971.1, NM_001283042.1 [Q9UHP3-1]
NP_037528.3, NM_013396.4 [Q9UHP3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000285679; ENSP00000285679; ENSG00000155313 [Q9UHP3-2]
ENST00000285681; ENSP00000285681; ENSG00000155313 [Q9UHP3-1]
ENST00000400183; ENSP00000383044; ENSG00000155313 [Q9UHP3-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		29761

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:29761

UCSC genome browser

More...UCSCi		uc002yjy.3, human [Q9UHP3-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF170562 mRNA Translation: AAF32263.1
AF134213 mRNA Translation: AAF24998.1
FJ763652 mRNA Translation: ACN76567.1
CH471079 Genomic DNA Translation: EAX10041.1
BC075792 mRNA Translation: AAH75792.1
AK022574 mRNA Translation: BAB14107.1
CCDSiCCDS33515.1 [Q9UHP3-2]
CCDS63336.1 [Q9UHP3-3]
CCDS63337.1 [Q9UHP3-1]
RefSeqiNP_001269970.1, NM_001283041.1 [Q9UHP3-3]
NP_001269971.1, NM_001283042.1 [Q9UHP3-1]
NP_037528.3, NM_013396.4 [Q9UHP3-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MUXNMR-A1-146[»]
5GP7X-ray1.50B1046-1055[»]
5O71X-ray3.28A1-714[»]
6H4JX-ray3.07A/B157-706[»]
6H4KX-ray2.05A765-1055[»]
6HELX-ray2.94A/B157-714[»]
6HEMX-ray1.72A748-1048[»]
BMRBiQ9UHP3
SMRiQ9UHP3
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi118895, 76 interactors
IntActiQ9UHP3, 38 interactors
STRINGi9606.ENSP00000383044

Chemistry databases

BindingDBiQ9UHP3
ChEMBLiCHEMBL4295975

Protein family/group databases

MEROPSiC19.041

PTM databases

iPTMnetiQ9UHP3
PhosphoSitePlusiQ9UHP3

Genetic variation databases

BioMutaiUSP25
DMDMi302393833

Proteomic databases

EPDiQ9UHP3
jPOSTiQ9UHP3
MassIVEiQ9UHP3
MaxQBiQ9UHP3
PaxDbiQ9UHP3
PeptideAtlasiQ9UHP3
PRIDEiQ9UHP3
ProteomicsDBi84385 [Q9UHP3-2]
84386 [Q9UHP3-1]
84387 [Q9UHP3-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		5805, 252 antibodies

The DNASU plasmid repository

More...DNASUi		29761

Genome annotation databases

EnsembliENST00000285679; ENSP00000285679; ENSG00000155313 [Q9UHP3-2]
ENST00000285681; ENSP00000285681; ENSG00000155313 [Q9UHP3-1]
ENST00000400183; ENSP00000383044; ENSG00000155313 [Q9UHP3-3]
GeneIDi29761
KEGGihsa:29761
UCSCiuc002yjy.3, human [Q9UHP3-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		29761
DisGeNETi29761

GeneCards: human genes, protein and diseases

More...GeneCardsi		USP25
HGNCiHGNC:12624, USP25
HPAiENSG00000155313, Low tissue specificity
MIMi604736, gene
neXtProtiNX_Q9UHP3
OpenTargetsiENSG00000155313
PharmGKBiPA37249
VEuPathDBiHostDB:ENSG00000155313

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1863, Eukaryota
GeneTreeiENSGT00940000157962
HOGENOMiCLU_012188_0_0_1
InParanoidiQ9UHP3
OMAiKGFNEPP
OrthoDBi194025at2759
PhylomeDBiQ9UHP3
TreeFamiTF329035

Enzyme and pathway databases

PathwayCommonsiQ9UHP3
ReactomeiR-HSA-5689880, Ub-specific processing proteases

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		29761, 3 hits in 1062 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		USP25, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		29761
PharosiQ9UHP3, Tbio

Protein Ontology

More...PROi		PR:Q9UHP3
RNActiQ9UHP3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000155313, Expressed in sperm and 240 other tissues
ExpressionAtlasiQ9UHP3, baseline and differential
GenevisibleiQ9UHP3, HS

Family and domain databases

InterProiView protein in InterPro
IPR038765, Papain-like_cys_pep_sf
IPR001394, Peptidase_C19_UCH
IPR009060, UBA-like_sf
IPR003903, UIM_dom
IPR018200, USP_CS
IPR028889, USP_dom
PfamiView protein in Pfam
PF00443, UCH, 1 hit
PF02809, UIM, 2 hits
SMARTiView protein in SMART
SM00726, UIM, 1 hit
SUPFAMiSSF46934, SSF46934, 1 hit
SSF54001, SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS50330, UIM, 1 hit
PS00972, USP_1, 1 hit
PS00973, USP_2, 1 hit
PS50235, USP_3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBP25_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UHP3
Secondary accession number(s): C0LSZ0, Q6DHZ9, Q9H9W1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: August 10, 2010
Last modified: September 29, 2021
This is version 197 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again