Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UHJ9 (PGAP2_HUMAN)

Entry version 128 (12 Aug 2020)
Sequence version 2 (18 Sep 2013)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Post-GPI attachment to proteins factor 2

Gene

PGAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processGPI-anchor biosynthesis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UHJ9

Protein family/group databases

Transport Classification Database

More...TCDBi		9.B.131.1.2, the post-gpi attachment protein (p-gap2) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Post-GPI attachment to proteins factor 2Curated
Alternative name(s):
FGF receptor-activating protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PGAP2Imported
Synonyms:FRAG1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000148985.19

Human Gene Nomenclature Database

More...HGNCi		HGNC:17893, PGAP2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		615187, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UHJ9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 23CytoplasmicSequence analysisAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei24 – 44HelicalSequence analysisAdd BLAST21
Topological domaini45 – 114LumenalSequence analysisAdd BLAST70
Transmembranei115 – 135HelicalSequence analysisAdd BLAST21
Topological domaini136 – 143CytoplasmicSequence analysis8
Transmembranei144 – 164HelicalSequence analysisAdd BLAST21
Topological domaini165 – 185LumenalSequence analysisAdd BLAST21
Transmembranei186 – 206HelicalSequence analysisAdd BLAST21
Topological domaini207 – 209CytoplasmicSequence analysis3
Transmembranei210 – 230HelicalSequence analysisAdd BLAST21
Topological domaini231 – 254LumenalSequence analysisAdd BLAST24

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hyperphosphatasia with mental retardation syndrome 3 (HPMRS3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder usually characterized by mental retardation, hypotonia with very poor motor development, poor speech, and increased serum alkaline phosphatase.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06966416R → W in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs773359554EnsemblClinVar.1
Natural variantiVAR_06966599Y → C in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255232Ensembl.1
Natural variantiVAR_069666127L → S in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255233Ensembl.1
Natural variantiVAR_069667160T → I in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs780188037Ensembl.1
Natural variantiVAR_069668177R → P in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs774843232Ensembl.1

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...DisGeNETi		27315

MalaCards human disease database

More...MalaCardsi		PGAP2
MIMi614207, phenotype

Open Targets

More...OpenTargetsi		ENSG00000148985

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		247262, Hyperphosphatasia-intellectual disability syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA165543520

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UHJ9, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PGAP2

Domain mapping of disease mutations (DMDM)

More...DMDMi		544584767

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003260941 – 254Post-GPI attachment to proteins factor 2Add BLAST254

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UHJ9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UHJ9

PeptideAtlas

More...PeptideAtlasi		Q9UHJ9

PRoteomics IDEntifications database

More...PRIDEi		Q9UHJ9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		21134
43326
84365 [Q9UHJ9-1]
84366 [Q9UHJ9-2]
84367 [Q9UHJ9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UHJ9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, with highest levels in testis and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000148985, Expressed in corpus epididymis and 227 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UHJ9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UHJ9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000148985, Tissue enhanced (epididymis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PGAP2IP.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		118133, 9 interactors

Protein interaction database and analysis system

More...IntActi		Q9UHJ9, 36 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000278243

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UHJ9, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PGAP2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3979, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00510000047299

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UHJ9

KEGG Orthology (KO)

More...KOi		K23552

Identification of Orthologs from Complete Genome Data

More...OMAi		HYREHIR

Database of Orthologous Groups

More...OrthoDBi		1166083at2759

TreeFam database of animal gene trees

More...TreeFami		TF314112

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR019402, Frag1/DRAM/Sfk1
IPR039545, PGAP2

The PANTHER Classification System

More...PANTHERi		PTHR12892, PTHR12892, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF10277, Frag1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q9UHJ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYQVPLPLDR DGTLVRLRFT MVALVTVCCP LVAFLFCILW SLLFHFKETT 
        60         70         80         90        100
ATHCGVPNYL PSVSSAIGGE VPQRYVWRFC IGLHSAPRFL VAFAYWNHYL 
       110        120        130        140        150
SCTSPCSCYR PLCRLNFGLN VVENLALLVL TYVSSSEDFT IHENAFIVFI 
       160        170        180        190        200
ASSLGHMLLT CILWRLTKKH TVSQEDRKSY SWKQRLFIIN FISFFSALAV 
       210        220        230        240        250
YFRHNMYCEA GVYTIFAILE YTVVLTNMAF HMTAWWDFGN KELLITSQPE 

EKRF
Length:254
Mass (Da):29,400
Last modified:September 18, 2013 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2FB502D505DCCF64
GO
Isoform 1 (identifier: Q9UHJ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-55: G → GATPCRMFSAASQPLDPDGTLFRLRFTAMVWWAITFPVFGFFFCIIWSLVFHFEYTVATDCG

Note: This isoform is predicted to contain an additional transmembrane domain at position 85-105. If this domain exists, the topology of the protein would be modified, possibly challenging the GPI-anchor remodeling function of the protein.Curated
Show »
Length:315
Mass (Da):36,417
Checksum:i64F89733A1F6270E
GO
Isoform 3 (identifier: Q9UHJ9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-175: Missing.

Show »
Length:250
Mass (Da):28,957
Checksum:i6B8A396B2A362942
GO
Isoform 4 (identifier: Q9UHJ9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-232: DRKSYSWKQR...VVLTNMAFHM → VRSIPSGGSK...GCLLSAQHVL
     233-254: Missing.

Show »
Length:232
Mass (Da):25,834
Checksum:i4D03E66290A066A2
GO
Isoform 5 (identifier: Q9UHJ9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARLGSTGGVSGRVVTQHRDSAPFLGAPRLGLRELGPIRGTAPEWHGRWNAAERSDKM
     172-175: Missing.

Show »
Length:307
Mass (Da):35,076
Checksum:i93344EC2DB02D17A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MS75A0A0A0MS75_HUMAN
Post-GPI attachment to proteins fac...
PGAP2 FRAG1, hCG_16163
272Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDQ4H0YDQ4_HUMAN
Post-GPI attachment to proteins fac...
PGAP2 FRAG1, hCG_16163
234Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDJ5H0YDJ5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
208Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MYS5A8MYS5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
311Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQ19E9PQ19_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
245Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKT0E9PKT0_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
94Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MZF5A8MZF5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
98Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRZ2E9PRZ2_HUMAN
Post-GPI attachment to proteins 2 i...
PGAP2
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCQ4H0YCQ4_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z2X5B7Z2X5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
211Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti73Q → H in AAF19156 (PubMed:10585768).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06966416R → W in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs773359554EnsemblClinVar.1
Natural variantiVAR_06966599Y → C in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255232Ensembl.1
Natural variantiVAR_069666127L → S in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255233Ensembl.1
Natural variantiVAR_069667160T → I in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs780188037Ensembl.1
Natural variantiVAR_069668177R → P in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs774843232Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0538001M → MARLGSTGGVSGRVVTQHRD SAPFLGAPRLGLRELGPIRG TAPEWHGRWNAAERSDKM in isoform 5. Curated1
Alternative sequenceiVSP_03255055G → GATPCRMFSAASQPLDPDGT LFRLRFTAMVWWAITFPVFG FFFCIIWSLVFHFEYTVATD CG in isoform 1. 2 Publications1
Alternative sequenceiVSP_032551172 – 175Missing in isoform 3 and isoform 5. 1 Publication4
Alternative sequenceiVSP_045984176 – 232DRKSY…MAFHM → VRSIPSGGSKAAQKKIKDIC PQDSGSQVLQLETAALHHQL HLLLLGAGCLLSAQHVL in isoform 4. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_045985233 – 254Missing in isoform 4. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF159615 mRNA Translation: AAF12755.1
BX379511 mRNA No translation available.
AY373030 mRNA Translation: AAQ75733.1
AF159621 AF159620 Genomic DNA Translation: AAF19156.1
AK292181 mRNA Translation: BAF84870.1
AC090587 Genomic DNA No translation available.
CH471158 Genomic DNA Translation: EAX02569.1
CH471158 Genomic DNA Translation: EAX02568.1
CH471158 Genomic DNA Translation: EAX02571.1
BC009930 mRNA Translation: AAH09930.1
AL096753 mRNA Translation: CAB46428.3

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44523.1 [Q9UHJ9-5]
CCDS58112.1 [Q9UHJ9-1]
CCDS58113.1 [Q9UHJ9-4]
CCDS7747.1 [Q9UHJ9-2]

Protein sequence database of the Protein Information Resource

More...PIRi		T12505

NCBI Reference Sequences

More...RefSeqi		NP_001138910.1, NM_001145438.2 [Q9UHJ9-5]
NP_001243164.1, NM_001256235.1
NP_001243165.1, NM_001256236.1
NP_001243166.1, NM_001256237.1
NP_001243167.1, NM_001256238.1 [Q9UHJ9-4]
NP_001243168.1, NM_001256239.1 [Q9UHJ9-3]
NP_001243169.1, NM_001256240.1 [Q9UHJ9-1]
NP_001269967.1, NM_001283038.1
NP_001269968.1, NM_001283039.1
NP_001269969.1, NM_001283040.1
NP_001333327.1, NM_001346398.1 [Q9UHJ9-1]
NP_001333329.1, NM_001346400.1 [Q9UHJ9-3]
NP_001333334.1, NM_001346405.1 [Q9UHJ9-1]
NP_055304.1, NM_014489.3 [Q9UHJ9-2]
XP_006718253.1, XM_006718190.3 [Q9UHJ9-1]
XP_006718254.1, XM_006718191.3 [Q9UHJ9-3]
XP_011518304.1, XM_011520002.1 [Q9UHJ9-3]
XP_011518305.1, XM_011520003.2 [Q9UHJ9-2]
XP_011518306.1, XM_011520004.2 [Q9UHJ9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000278243; ENSP00000278243; ENSG00000148985 [Q9UHJ9-2]
ENST00000300730; ENSP00000300730; ENSG00000148985 [Q9UHJ9-5]
ENST00000463452; ENSP00000435223; ENSG00000148985 [Q9UHJ9-1]
ENST00000464906; ENSP00000434631; ENSG00000148985 [Q9UHJ9-2]
ENST00000493547; ENSP00000431851; ENSG00000148985 [Q9UHJ9-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		27315

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:27315

UCSC genome browser

More...UCSCi		uc001lys.5, human [Q9UHJ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF159615 mRNA Translation: AAF12755.1
BX379511 mRNA No translation available.
AY373030 mRNA Translation: AAQ75733.1
AF159621 AF159620 Genomic DNA Translation: AAF19156.1
AK292181 mRNA Translation: BAF84870.1
AC090587 Genomic DNA No translation available.
CH471158 Genomic DNA Translation: EAX02569.1
CH471158 Genomic DNA Translation: EAX02568.1
CH471158 Genomic DNA Translation: EAX02571.1
BC009930 mRNA Translation: AAH09930.1
AL096753 mRNA Translation: CAB46428.3
CCDSiCCDS44523.1 [Q9UHJ9-5]
CCDS58112.1 [Q9UHJ9-1]
CCDS58113.1 [Q9UHJ9-4]
CCDS7747.1 [Q9UHJ9-2]
PIRiT12505
RefSeqiNP_001138910.1, NM_001145438.2 [Q9UHJ9-5]
NP_001243164.1, NM_001256235.1
NP_001243165.1, NM_001256236.1
NP_001243166.1, NM_001256237.1
NP_001243167.1, NM_001256238.1 [Q9UHJ9-4]
NP_001243168.1, NM_001256239.1 [Q9UHJ9-3]
NP_001243169.1, NM_001256240.1 [Q9UHJ9-1]
NP_001269967.1, NM_001283038.1
NP_001269968.1, NM_001283039.1
NP_001269969.1, NM_001283040.1
NP_001333327.1, NM_001346398.1 [Q9UHJ9-1]
NP_001333329.1, NM_001346400.1 [Q9UHJ9-3]
NP_001333334.1, NM_001346405.1 [Q9UHJ9-1]
NP_055304.1, NM_014489.3 [Q9UHJ9-2]
XP_006718253.1, XM_006718190.3 [Q9UHJ9-1]
XP_006718254.1, XM_006718191.3 [Q9UHJ9-3]
XP_011518304.1, XM_011520002.1 [Q9UHJ9-3]
XP_011518305.1, XM_011520003.2 [Q9UHJ9-2]
XP_011518306.1, XM_011520004.2 [Q9UHJ9-2]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi118133, 9 interactors
IntActiQ9UHJ9, 36 interactors
STRINGi9606.ENSP00000278243

Protein family/group databases

TCDBi9.B.131.1.2, the post-gpi attachment protein (p-gap2) family

PTM databases

iPTMnetiQ9UHJ9

Polymorphism and mutation databases

BioMutaiPGAP2
DMDMi544584767

Proteomic databases

MassIVEiQ9UHJ9
PaxDbiQ9UHJ9
PeptideAtlasiQ9UHJ9
PRIDEiQ9UHJ9
ProteomicsDBi21134
43326
84365 [Q9UHJ9-1]
84366 [Q9UHJ9-2]
84367 [Q9UHJ9-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		42139, 81 antibodies

The DNASU plasmid repository

More...DNASUi		27315

Genome annotation databases

EnsembliENST00000278243; ENSP00000278243; ENSG00000148985 [Q9UHJ9-2]
ENST00000300730; ENSP00000300730; ENSG00000148985 [Q9UHJ9-5]
ENST00000463452; ENSP00000435223; ENSG00000148985 [Q9UHJ9-1]
ENST00000464906; ENSP00000434631; ENSG00000148985 [Q9UHJ9-2]
ENST00000493547; ENSP00000431851; ENSG00000148985 [Q9UHJ9-4]
GeneIDi27315
KEGGihsa:27315
UCSCiuc001lys.5, human [Q9UHJ9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		27315
DisGeNETi27315
EuPathDBiHostDB:ENSG00000148985.19

GeneCards: human genes, protein and diseases

More...GeneCardsi		PGAP2
HGNCiHGNC:17893, PGAP2
HPAiENSG00000148985, Tissue enhanced (epididymis)
MalaCardsiPGAP2
MIMi614207, phenotype
615187, gene
neXtProtiNX_Q9UHJ9
OpenTargetsiENSG00000148985
Orphaneti247262, Hyperphosphatasia-intellectual disability syndrome
PharmGKBiPA165543520

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3979, Eukaryota
GeneTreeiENSGT00510000047299
InParanoidiQ9UHJ9
KOiK23552
OMAiHYREHIR
OrthoDBi1166083at2759
TreeFamiTF314112

Enzyme and pathway databases

PathwayCommonsiQ9UHJ9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		27315, 10 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PGAP2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		27315
PharosiQ9UHJ9, Tbio

Protein Ontology

More...PROi		PR:Q9UHJ9
RNActiQ9UHJ9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000148985, Expressed in corpus epididymis and 227 other tissues
ExpressionAtlasiQ9UHJ9, baseline and differential
GenevisibleiQ9UHJ9, HS

Family and domain databases

InterProiView protein in InterPro
IPR019402, Frag1/DRAM/Sfk1
IPR039545, PGAP2
PANTHERiPTHR12892, PTHR12892, 1 hit
PfamiView protein in Pfam
PF10277, Frag1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPGAP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UHJ9
Secondary accession number(s): E9PJG5
, H7BXL9, Q6UC77, Q96G66, Q9UF01, Q9Y4N1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: September 18, 2013
Last modified: August 12, 2020
This is version 128 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again