Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (18 Sep 2019)
Sequence version 2 (18 Sep 2013)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Post-GPI attachment to proteins factor 2

Gene

PGAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processGPI-anchor biosynthesis

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.131.1.2 the post-gpi attachment protein (p-gap2) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Post-GPI attachment to proteins factor 2
Alternative name(s):
FGF receptor-activating protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PGAP2
Synonyms:FRAG1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17893 PGAP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615187 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UHJ9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 23CytoplasmicSequence analysisAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei24 – 44HelicalSequence analysisAdd BLAST21
Topological domaini45 – 114LumenalSequence analysisAdd BLAST70
Transmembranei115 – 135HelicalSequence analysisAdd BLAST21
Topological domaini136 – 143CytoplasmicSequence analysis8
Transmembranei144 – 164HelicalSequence analysisAdd BLAST21
Topological domaini165 – 185LumenalSequence analysisAdd BLAST21
Transmembranei186 – 206HelicalSequence analysisAdd BLAST21
Topological domaini207 – 209CytoplasmicSequence analysis3
Transmembranei210 – 230HelicalSequence analysisAdd BLAST21
Topological domaini231 – 254LumenalSequence analysisAdd BLAST24

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hyperphosphatasia with mental retardation syndrome 3 (HPMRS3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder usually characterized by mental retardation, hypotonia with very poor motor development, poor speech, and increased serum alkaline phosphatase.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06966416R → W in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs773359554EnsemblClinVar.1
Natural variantiVAR_06966599Y → C in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255232EnsemblClinVar.1
Natural variantiVAR_069666127L → S in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255233EnsemblClinVar.1
Natural variantiVAR_069667160T → I in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs780188037Ensembl.1
Natural variantiVAR_069668177R → P in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs774843232EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
27315

MalaCards human disease database

More...
MalaCardsi
PGAP2
MIMi614207 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000148985

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
247262 Hyperphosphatasia-intellectual disability syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165543520

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PGAP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
544584767

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003260941 – 254Post-GPI attachment to proteins factor 2Add BLAST254

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UHJ9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UHJ9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UHJ9

PeptideAtlas

More...
PeptideAtlasi
Q9UHJ9

PRoteomics IDEntifications database

More...
PRIDEi
Q9UHJ9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
21134
43326
84365 [Q9UHJ9-1]
84366 [Q9UHJ9-2]
84367 [Q9UHJ9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UHJ9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, with highest levels in testis and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000148985 Expressed in 213 organ(s), highest expression level in corpus epididymis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UHJ9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UHJ9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA063099

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PGAP2IP.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118133, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UHJ9, 35 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000278243

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PGAP2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3979 Eukaryota
ENOG410XT2T LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000047299

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006821

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UHJ9

Identification of Orthologs from Complete Genome Data

More...
OMAi
HYREHIR

Database of Orthologous Groups

More...
OrthoDBi
1166083at2759

TreeFam database of animal gene trees

More...
TreeFami
TF314112

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019402 Frag1/DRAM/Sfk1
IPR039545 PGAP2

The PANTHER Classification System

More...
PANTHERi
PTHR12892 PTHR12892, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10277 Frag1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q9UHJ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYQVPLPLDR DGTLVRLRFT MVALVTVCCP LVAFLFCILW SLLFHFKETT
60 70 80 90 100
ATHCGVPNYL PSVSSAIGGE VPQRYVWRFC IGLHSAPRFL VAFAYWNHYL
110 120 130 140 150
SCTSPCSCYR PLCRLNFGLN VVENLALLVL TYVSSSEDFT IHENAFIVFI
160 170 180 190 200
ASSLGHMLLT CILWRLTKKH TVSQEDRKSY SWKQRLFIIN FISFFSALAV
210 220 230 240 250
YFRHNMYCEA GVYTIFAILE YTVVLTNMAF HMTAWWDFGN KELLITSQPE

EKRF
Length:254
Mass (Da):29,400
Last modified:September 18, 2013 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2FB502D505DCCF64
GO
Isoform 1 (identifier: Q9UHJ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-55: G → GATPCRMFSAASQPLDPDGTLFRLRFTAMVWWAITFPVFGFFFCIIWSLVFHFEYTVATDCG

Note: This isoform is predicted to contain an additional transmembrane domain at position 85-105. If this domain exists, the topology of the protein would be modified, possibly challenging the GPI-anchor remodeling function of the protein.
Show »
Length:315
Mass (Da):36,417
Checksum:i64F89733A1F6270E
GO
Isoform 3 (identifier: Q9UHJ9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-175: Missing.

Show »
Length:250
Mass (Da):28,957
Checksum:i6B8A396B2A362942
GO
Isoform 4 (identifier: Q9UHJ9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-232: DRKSYSWKQR...VVLTNMAFHM → VRSIPSGGSK...GCLLSAQHVL
     233-254: Missing.

Note: No experimental confirmation available.
Show »
Length:232
Mass (Da):25,834
Checksum:i4D03E66290A066A2
GO
Isoform 5 (identifier: Q9UHJ9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARLGSTGGVSGRVVTQHRDSAPFLGAPRLGLRELGPIRGTAPEWHGRWNAAERSDKM
     172-175: Missing.

Note: No experimental confirmation available.
Show »
Length:307
Mass (Da):35,076
Checksum:i93344EC2DB02D17A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MS75A0A0A0MS75_HUMAN
FGF receptor activating protein 1, ...
PGAP2 FRAG1, hCG_16163
272Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRZ2E9PRZ2_HUMAN
Post-GPI attachment to proteins 2 i...
PGAP2
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDQ4H0YDQ4_HUMAN
FGF receptor activating protein 1, ...
PGAP2 FRAG1, hCG_16163
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDJ5H0YDJ5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MYS5A8MYS5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
311Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MZF5A8MZF5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKT0E9PKT0_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQ19E9PQ19_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCQ4H0YCQ4_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z2X5B7Z2X5_HUMAN
Post-GPI attachment to proteins fac...
PGAP2
211Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti73Q → H in AAF19156 (PubMed:10585768).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06966416R → W in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs773359554EnsemblClinVar.1
Natural variantiVAR_06966599Y → C in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255232EnsemblClinVar.1
Natural variantiVAR_069666127L → S in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs879255233EnsemblClinVar.1
Natural variantiVAR_069667160T → I in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs780188037Ensembl.1
Natural variantiVAR_069668177R → P in HPMRS3. 1 PublicationCorresponds to variant dbSNP:rs774843232EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0538001M → MARLGSTGGVSGRVVTQHRD SAPFLGAPRLGLRELGPIRG TAPEWHGRWNAAERSDKM in isoform 5. Curated1
Alternative sequenceiVSP_03255055G → GATPCRMFSAASQPLDPDGT LFRLRFTAMVWWAITFPVFG FFFCIIWSLVFHFEYTVATD CG in isoform 1. 2 Publications1
Alternative sequenceiVSP_032551172 – 175Missing in isoform 3 and isoform 5. 1 Publication4
Alternative sequenceiVSP_045984176 – 232DRKSY…MAFHM → VRSIPSGGSKAAQKKIKDIC PQDSGSQVLQLETAALHHQL HLLLLGAGCLLSAQHVL in isoform 4. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_045985233 – 254Missing in isoform 4. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF159615 mRNA Translation: AAF12755.1
BX379511 mRNA No translation available.
AY373030 mRNA Translation: AAQ75733.1
AF159621
, AF159616, AF159617, AF159618, AF159619, AF159620 Genomic DNA Translation: AAF19156.1
AK292181 mRNA Translation: BAF84870.1
AC090587 Genomic DNA No translation available.
CH471158 Genomic DNA Translation: EAX02569.1
CH471158 Genomic DNA Translation: EAX02568.1
CH471158 Genomic DNA Translation: EAX02571.1
BC009930 mRNA Translation: AAH09930.1
AL096753 mRNA Translation: CAB46428.3

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44523.1 [Q9UHJ9-5]
CCDS58112.1 [Q9UHJ9-1]
CCDS58113.1 [Q9UHJ9-4]
CCDS7747.1 [Q9UHJ9-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T12505

NCBI Reference Sequences

More...
RefSeqi
NP_001138910.1, NM_001145438.2 [Q9UHJ9-5]
NP_001243164.1, NM_001256235.1
NP_001243165.1, NM_001256236.1
NP_001243166.1, NM_001256237.1
NP_001243167.1, NM_001256238.1 [Q9UHJ9-4]
NP_001243168.1, NM_001256239.1 [Q9UHJ9-3]
NP_001243169.1, NM_001256240.1 [Q9UHJ9-1]
NP_001269967.1, NM_001283038.1
NP_001269968.1, NM_001283039.1
NP_001269969.1, NM_001283040.1
NP_001333327.1, NM_001346398.1 [Q9UHJ9-1]
NP_001333329.1, NM_001346400.1 [Q9UHJ9-3]
NP_001333334.1, NM_001346405.1 [Q9UHJ9-1]
NP_055304.1, NM_014489.3 [Q9UHJ9-2]
XP_006718253.1, XM_006718190.3 [Q9UHJ9-1]
XP_006718254.1, XM_006718191.3 [Q9UHJ9-3]
XP_011518304.1, XM_011520002.1 [Q9UHJ9-3]
XP_011518305.1, XM_011520003.2 [Q9UHJ9-2]
XP_011518306.1, XM_011520004.2 [Q9UHJ9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000278243; ENSP00000278243; ENSG00000148985 [Q9UHJ9-2]
ENST00000300730; ENSP00000300730; ENSG00000148985 [Q9UHJ9-5]
ENST00000463452; ENSP00000435223; ENSG00000148985 [Q9UHJ9-1]
ENST00000464906; ENSP00000434631; ENSG00000148985 [Q9UHJ9-2]
ENST00000493547; ENSP00000431851; ENSG00000148985 [Q9UHJ9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
27315

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:27315

UCSC genome browser

More...
UCSCi
uc001lys.5 human [Q9UHJ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF159615 mRNA Translation: AAF12755.1
BX379511 mRNA No translation available.
AY373030 mRNA Translation: AAQ75733.1
AF159621
, AF159616, AF159617, AF159618, AF159619, AF159620 Genomic DNA Translation: AAF19156.1
AK292181 mRNA Translation: BAF84870.1
AC090587 Genomic DNA No translation available.
CH471158 Genomic DNA Translation: EAX02569.1
CH471158 Genomic DNA Translation: EAX02568.1
CH471158 Genomic DNA Translation: EAX02571.1
BC009930 mRNA Translation: AAH09930.1
AL096753 mRNA Translation: CAB46428.3
CCDSiCCDS44523.1 [Q9UHJ9-5]
CCDS58112.1 [Q9UHJ9-1]
CCDS58113.1 [Q9UHJ9-4]
CCDS7747.1 [Q9UHJ9-2]
PIRiT12505
RefSeqiNP_001138910.1, NM_001145438.2 [Q9UHJ9-5]
NP_001243164.1, NM_001256235.1
NP_001243165.1, NM_001256236.1
NP_001243166.1, NM_001256237.1
NP_001243167.1, NM_001256238.1 [Q9UHJ9-4]
NP_001243168.1, NM_001256239.1 [Q9UHJ9-3]
NP_001243169.1, NM_001256240.1 [Q9UHJ9-1]
NP_001269967.1, NM_001283038.1
NP_001269968.1, NM_001283039.1
NP_001269969.1, NM_001283040.1
NP_001333327.1, NM_001346398.1 [Q9UHJ9-1]
NP_001333329.1, NM_001346400.1 [Q9UHJ9-3]
NP_001333334.1, NM_001346405.1 [Q9UHJ9-1]
NP_055304.1, NM_014489.3 [Q9UHJ9-2]
XP_006718253.1, XM_006718190.3 [Q9UHJ9-1]
XP_006718254.1, XM_006718191.3 [Q9UHJ9-3]
XP_011518304.1, XM_011520002.1 [Q9UHJ9-3]
XP_011518305.1, XM_011520003.2 [Q9UHJ9-2]
XP_011518306.1, XM_011520004.2 [Q9UHJ9-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi118133, 9 interactors
IntActiQ9UHJ9, 35 interactors
STRINGi9606.ENSP00000278243

Protein family/group databases

TCDBi9.B.131.1.2 the post-gpi attachment protein (p-gap2) family

PTM databases

iPTMnetiQ9UHJ9

Polymorphism and mutation databases

BioMutaiPGAP2
DMDMi544584767

Proteomic databases

jPOSTiQ9UHJ9
MassIVEiQ9UHJ9
PaxDbiQ9UHJ9
PeptideAtlasiQ9UHJ9
PRIDEiQ9UHJ9
ProteomicsDBi21134
43326
84365 [Q9UHJ9-1]
84366 [Q9UHJ9-2]
84367 [Q9UHJ9-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
27315
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000278243; ENSP00000278243; ENSG00000148985 [Q9UHJ9-2]
ENST00000300730; ENSP00000300730; ENSG00000148985 [Q9UHJ9-5]
ENST00000463452; ENSP00000435223; ENSG00000148985 [Q9UHJ9-1]
ENST00000464906; ENSP00000434631; ENSG00000148985 [Q9UHJ9-2]
ENST00000493547; ENSP00000431851; ENSG00000148985 [Q9UHJ9-4]
GeneIDi27315
KEGGihsa:27315
UCSCiuc001lys.5 human [Q9UHJ9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27315
DisGeNETi27315

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PGAP2
HGNCiHGNC:17893 PGAP2
HPAiHPA063099
MalaCardsiPGAP2
MIMi614207 phenotype
615187 gene
neXtProtiNX_Q9UHJ9
OpenTargetsiENSG00000148985
Orphaneti247262 Hyperphosphatasia-intellectual disability syndrome
PharmGKBiPA165543520

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3979 Eukaryota
ENOG410XT2T LUCA
GeneTreeiENSGT00510000047299
HOGENOMiHOG000006821
InParanoidiQ9UHJ9
OMAiHYREHIR
OrthoDBi1166083at2759
TreeFamiTF314112

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PGAP2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
27315

Pharos

More...
Pharosi
Q9UHJ9

Protein Ontology

More...
PROi
PR:Q9UHJ9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000148985 Expressed in 213 organ(s), highest expression level in corpus epididymis
ExpressionAtlasiQ9UHJ9 baseline and differential
GenevisibleiQ9UHJ9 HS

Family and domain databases

InterProiView protein in InterPro
IPR019402 Frag1/DRAM/Sfk1
IPR039545 PGAP2
PANTHERiPTHR12892 PTHR12892, 1 hit
PfamiView protein in Pfam
PF10277 Frag1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPGAP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UHJ9
Secondary accession number(s): E9PJG5
, H7BXL9, Q6UC77, Q96G66, Q9UF01, Q9Y4N1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: September 18, 2013
Last modified: September 18, 2019
This is version 122 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again