Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Inositol hexakisphosphate kinase 2

Gene

IP6K2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.1 Publication

Catalytic activityi

ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.
ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS00942-MONOMER
BRENDAi2.7.4.21 2681
ReactomeiR-HSA-1855191 Synthesis of IPs in the nucleus
R-HSA-909733 Interferon alpha/beta signaling
SABIO-RKiQ9UHH9

Names & Taxonomyi

Protein namesi
Recommended name:
Inositol hexakisphosphate kinase 2 (EC:2.7.4.21)
Short name:
InsP6 kinase 2
Alternative name(s):
P(i)-uptake stimulator
Short name:
PiUS
Gene namesi
Name:IP6K2
Synonyms:IHPK2
ORF Names:TCCCIA00113
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000068745.14
HGNCiHGNC:17313 IP6K2
MIMi606992 gene
neXtProtiNX_Q9UHH9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51447
OpenTargetsiENSG00000068745
PharmGKBiPA164720999

Polymorphism and mutation databases

BioMutaiIP6K2
DMDMi50400688

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000668771 – 426Inositol hexakisphosphate kinase 2Add BLAST426

Proteomic databases

EPDiQ9UHH9
PaxDbiQ9UHH9
PeptideAtlasiQ9UHH9
PRIDEiQ9UHH9
ProteomicsDBi84351
84352 [Q9UHH9-2]
84353 [Q9UHH9-3]
84354 [Q9UHH9-4]
84355 [Q9UHH9-5]

PTM databases

iPTMnetiQ9UHH9
PhosphoSitePlusiQ9UHH9

Expressioni

Gene expression databases

BgeeiENSG00000068745 Expressed in 215 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_IP6K2
ExpressionAtlasiQ9UHH9 baseline and differential
GenevisibleiQ9UHH9 HS

Organism-specific databases

HPAiHPA007532
HPA070811

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi119546, 13 interactors
DIPiDIP-29676N
IntActiQ9UHH9, 9 interactors
MINTiQ9UHH9
STRINGi9606.ENSP00000331103

Structurei

3D structure databases

ProteinModelPortaliQ9UHH9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni216 – 224Substrate bindingBy similarity9

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1620 Eukaryota
ENOG410YB60 LUCA
GeneTreeiENSGT00390000014381
HOVERGENiHBG052140
InParanoidiQ9UHH9
KOiK07756
OMAiLRWTNKK
OrthoDBiEOG091G0JK2
PhylomeDBiQ9UHH9
TreeFamiTF314066

Family and domain databases

Gene3Di1.10.510.50, 1 hit
InterProiView protein in InterPro
IPR005522 IPK
IPR038286 IPK_sf
PANTHERiPTHR12400 PTHR12400, 1 hit
PfamiView protein in Pfam
PF03770 IPK, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UHH9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPAFRAMDV EPRAKGVLLE PFVHQVGGHS CVLRFNETTL CKPLVPREHQ
60 70 80 90 100
FYETLPAEMR KFTPQYKGVV SVRFEEDEDR NLCLIAYPLK GDHGIVDIVD
110 120 130 140 150
NSDCEPKSKL LRWTTNKKHH VLETEKTPKD WVRQHRKEEK MKSHKLEEEF
160 170 180 190 200
EWLKKSEVLY YTVEKKGNIS SQLKHYNPWS MKCHQQQLQR MKENAKHRNQ
210 220 230 240 250
YKFILLENLT SRYEVPCVLD LKMGTRQHGD DASEEKAANQ IRKCQQSTSA
260 270 280 290 300
VIGVRVCGMQ VYQAGSGQLM FMNKYHGRKL SVQGFKEALF QFFHNGRYLR
310 320 330 340 350
RELLGPVLKK LTELKAVLER QESYRFYSSS LLVIYDGKER PEVVLDSDAE
360 370 380 390 400
DLEDLSEESA DESAGAYAYK PIGASSVDVR MIDFAHTTCR LYGEDTVVHE
410 420
GQDAGYIFGL QSLIDIVTEI SEESGE
Length:426
Mass (Da):49,186
Last modified:July 19, 2004 - v2
Checksum:i11BDFF12C22EECFB
GO
Isoform 2 (identifier: Q9UHH9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-97: VVSVRFEEDEDRNLCLIAYPLKGDHGIVD → QSQRPLVSWPSLPHFFPWSFPLWPQGSVA
     98-426: Missing.

Show »
Length:97
Mass (Da):11,180
Checksum:i20CD12C8CB9E4287
GO
Isoform 3 (identifier: Q9UHH9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: V → S
     71-426: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:70
Mass (Da):8,004
Checksum:iB44FEE3FD8C14391
GO
Isoform 4 (identifier: Q9UHH9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSLNLPEASLLSRASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.

Show »
Length:185
Mass (Da):20,924
Checksum:iD52B5B42D42D1472
GO
Isoform 5 (identifier: Q9UHH9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNLCQSPFQEGCQSLLASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.

Show »
Length:188
Mass (Da):21,291
Checksum:i86D9872EAD7F79F6
GO
Isoform 6 (identifier: Q9UHH9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-87: VVSVRFEEDEDRNLCLIAY → DISSHQHGGVFVGEWGSLL
     88-426: Missing.

Note: No experimental confirmation available.
Show »
Length:87
Mass (Da):9,825
Checksum:i30E2F170A5B95C9B
GO

Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J124C9J124_HUMAN
Kinase
IP6K2
140Annotation score:
C9J790C9J790_HUMAN
Kinase
IP6K2
95Annotation score:
C9JRM0C9JRM0_HUMAN
Kinase
IP6K2
151Annotation score:
C9J3W9C9J3W9_HUMAN
Kinase
IP6K2
148Annotation score:
C9JMC9C9JMC9_HUMAN
Kinase
IP6K2
100Annotation score:
F8WDQ5F8WDQ5_HUMAN
Kinase
IP6K2
128Annotation score:
C9J536C9J536_HUMAN
Kinase
IP6K2
130Annotation score:
C9JLG7C9JLG7_HUMAN
Kinase
IP6K2
104Annotation score:
C9J8W6C9J8W6_HUMAN
Kinase
IP6K2
189Annotation score:
C9JHX0C9JHX0_HUMAN
Kinase
IP6K2
91Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti99 – 100VD → AH in AAF15057 (PubMed:10574768).Curated2
Sequence conflicti167G → W in AAH65533 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0426981M → MSLNLPEASLLSRASWPEQA KEPRREGHTDKQQTEDVLAA GLRCLPHLPAICARRM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0428451M → MNLCQSPFQEGCQSLLASWP EQAKEPRREGHTDKQQTEDV LAAGLRCLPHLPAICARRM in isoform 5. 1 Publication1
Alternative sequenceiVSP_04269969 – 130VVSVR…KTPKD → KSQLLEGLPHWRGDVRDRGH GRPWQPSLEPSLPPTLCFPS LSSFSSSWPSAQHLTPSVFN PW in isoform 4 and isoform 5. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_01092569 – 97VVSVR…HGIVD → QSQRPLVSWPSLPHFFPWSF PLWPQGSVA in isoform 2. 2 PublicationsAdd BLAST29
Alternative sequenceiVSP_04541669 – 87VVSVR…CLIAY → DISSHQHGGVFVGEWGSLL in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01092670V → S in isoform 3. 1 Publication1
Alternative sequenceiVSP_01092771 – 426Missing in isoform 3. 1 PublicationAdd BLAST356
Alternative sequenceiVSP_04541788 – 426Missing in isoform 6. 1 PublicationAdd BLAST339
Alternative sequenceiVSP_01092898 – 426Missing in isoform 2. 2 PublicationsAdd BLAST329
Alternative sequenceiVSP_042700131 – 426Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST296

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF177145 mRNA Translation: AAF15057.1
AY007091 mRNA Translation: AAG01984.1
AK290526 mRNA Translation: BAF83215.1
AK304714 mRNA Translation: BAG65478.1
AC141002 Genomic DNA No translation available.
BC001864 mRNA No translation available.
BC004469 mRNA Translation: AAH04469.2
BC019694 mRNA Translation: AAH19694.1
BC065533 mRNA Translation: AAH65533.1
CA488567 mRNA No translation available.
AL117458 mRNA Translation: CAB55936.1
AL137514 mRNA Translation: CAB70780.1
CCDSiCCDS2777.1 [Q9UHH9-1]
CCDS33752.1 [Q9UHH9-2]
CCDS54579.1 [Q9UHH9-6]
CCDS54580.1 [Q9UHH9-4]
CCDS54581.1 [Q9UHH9-5]
PIRiT17246
T46275
RefSeqiNP_001005909.1, NM_001005909.2 [Q9UHH9-1]
NP_001005910.1, NM_001005910.2 [Q9UHH9-2]
NP_001005911.1, NM_001005911.2 [Q9UHH9-2]
NP_001139650.1, NM_001146178.2 [Q9UHH9-6]
NP_001139651.1, NM_001146179.2 [Q9UHH9-6]
NP_001177245.1, NM_001190316.1 [Q9UHH9-4]
NP_001177246.1, NM_001190317.1 [Q9UHH9-5]
NP_057375.2, NM_016291.3 [Q9UHH9-1]
XP_011532124.1, XM_011533822.1 [Q9UHH9-6]
XP_011532125.1, XM_011533823.1 [Q9UHH9-6]
XP_016862072.1, XM_017006583.1 [Q9UHH9-1]
XP_016862073.1, XM_017006584.1 [Q9UHH9-1]
XP_016862074.1, XM_017006585.1 [Q9UHH9-1]
UniGeneiHs.595983

Genome annotation databases

EnsembliENST00000328631; ENSP00000331103; ENSG00000068745 [Q9UHH9-1]
ENST00000340879; ENSP00000341925; ENSG00000068745 [Q9UHH9-2]
ENST00000413298; ENSP00000396203; ENSG00000068745 [Q9UHH9-2]
ENST00000416707; ENSP00000387759; ENSG00000068745 [Q9UHH9-3]
ENST00000431721; ENSP00000414139; ENSG00000068745 [Q9UHH9-4]
ENST00000432678; ENSP00000400812; ENSG00000068745 [Q9UHH9-6]
ENST00000446860; ENSP00000399052; ENSG00000068745 [Q9UHH9-5]
GeneIDi51447
KEGGihsa:51447
UCSCiuc003cuq.4 human [Q9UHH9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF177145 mRNA Translation: AAF15057.1
AY007091 mRNA Translation: AAG01984.1
AK290526 mRNA Translation: BAF83215.1
AK304714 mRNA Translation: BAG65478.1
AC141002 Genomic DNA No translation available.
BC001864 mRNA No translation available.
BC004469 mRNA Translation: AAH04469.2
BC019694 mRNA Translation: AAH19694.1
BC065533 mRNA Translation: AAH65533.1
CA488567 mRNA No translation available.
AL117458 mRNA Translation: CAB55936.1
AL137514 mRNA Translation: CAB70780.1
CCDSiCCDS2777.1 [Q9UHH9-1]
CCDS33752.1 [Q9UHH9-2]
CCDS54579.1 [Q9UHH9-6]
CCDS54580.1 [Q9UHH9-4]
CCDS54581.1 [Q9UHH9-5]
PIRiT17246
T46275
RefSeqiNP_001005909.1, NM_001005909.2 [Q9UHH9-1]
NP_001005910.1, NM_001005910.2 [Q9UHH9-2]
NP_001005911.1, NM_001005911.2 [Q9UHH9-2]
NP_001139650.1, NM_001146178.2 [Q9UHH9-6]
NP_001139651.1, NM_001146179.2 [Q9UHH9-6]
NP_001177245.1, NM_001190316.1 [Q9UHH9-4]
NP_001177246.1, NM_001190317.1 [Q9UHH9-5]
NP_057375.2, NM_016291.3 [Q9UHH9-1]
XP_011532124.1, XM_011533822.1 [Q9UHH9-6]
XP_011532125.1, XM_011533823.1 [Q9UHH9-6]
XP_016862072.1, XM_017006583.1 [Q9UHH9-1]
XP_016862073.1, XM_017006584.1 [Q9UHH9-1]
XP_016862074.1, XM_017006585.1 [Q9UHH9-1]
UniGeneiHs.595983

3D structure databases

ProteinModelPortaliQ9UHH9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119546, 13 interactors
DIPiDIP-29676N
IntActiQ9UHH9, 9 interactors
MINTiQ9UHH9
STRINGi9606.ENSP00000331103

PTM databases

iPTMnetiQ9UHH9
PhosphoSitePlusiQ9UHH9

Polymorphism and mutation databases

BioMutaiIP6K2
DMDMi50400688

Proteomic databases

EPDiQ9UHH9
PaxDbiQ9UHH9
PeptideAtlasiQ9UHH9
PRIDEiQ9UHH9
ProteomicsDBi84351
84352 [Q9UHH9-2]
84353 [Q9UHH9-3]
84354 [Q9UHH9-4]
84355 [Q9UHH9-5]

Protocols and materials databases

DNASUi51447
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328631; ENSP00000331103; ENSG00000068745 [Q9UHH9-1]
ENST00000340879; ENSP00000341925; ENSG00000068745 [Q9UHH9-2]
ENST00000413298; ENSP00000396203; ENSG00000068745 [Q9UHH9-2]
ENST00000416707; ENSP00000387759; ENSG00000068745 [Q9UHH9-3]
ENST00000431721; ENSP00000414139; ENSG00000068745 [Q9UHH9-4]
ENST00000432678; ENSP00000400812; ENSG00000068745 [Q9UHH9-6]
ENST00000446860; ENSP00000399052; ENSG00000068745 [Q9UHH9-5]
GeneIDi51447
KEGGihsa:51447
UCSCiuc003cuq.4 human [Q9UHH9-1]

Organism-specific databases

CTDi51447
DisGeNETi51447
EuPathDBiHostDB:ENSG00000068745.14
GeneCardsiIP6K2
HGNCiHGNC:17313 IP6K2
HPAiHPA007532
HPA070811
MIMi606992 gene
neXtProtiNX_Q9UHH9
OpenTargetsiENSG00000068745
PharmGKBiPA164720999
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1620 Eukaryota
ENOG410YB60 LUCA
GeneTreeiENSGT00390000014381
HOVERGENiHBG052140
InParanoidiQ9UHH9
KOiK07756
OMAiLRWTNKK
OrthoDBiEOG091G0JK2
PhylomeDBiQ9UHH9
TreeFamiTF314066

Enzyme and pathway databases

BioCyciMetaCyc:HS00942-MONOMER
BRENDAi2.7.4.21 2681
ReactomeiR-HSA-1855191 Synthesis of IPs in the nucleus
R-HSA-909733 Interferon alpha/beta signaling
SABIO-RKiQ9UHH9

Miscellaneous databases

ChiTaRSiIP6K2 human
GeneWikiiIHPK2
GenomeRNAii51447
PROiPR:Q9UHH9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000068745 Expressed in 215 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_IP6K2
ExpressionAtlasiQ9UHH9 baseline and differential
GenevisibleiQ9UHH9 HS

Family and domain databases

Gene3Di1.10.510.50, 1 hit
InterProiView protein in InterPro
IPR005522 IPK
IPR038286 IPK_sf
PANTHERiPTHR12400 PTHR12400, 1 hit
PfamiView protein in Pfam
PF03770 IPK, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiIP6K2_HUMAN
AccessioniPrimary (citable) accession number: Q9UHH9
Secondary accession number(s): A8K3B1
, B4E3G6, G8JLL6, Q6P0N8, Q9BSZ6, Q9BUW3, Q9H4P7, Q9NT63, Q9UFU6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: September 12, 2018
This is version 145 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again