Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (17 Jun 2020)
Sequence version 2 (19 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Inositol hexakisphosphate kinase 2

Gene

IP6K2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by flavonoids, including myricetin, quercetin, luteolin, isorhamnetin, rhamnetin, kaempferol, diosmetin and apigenin.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=3.0 µM for inositol hexakisphosphate1 Publication
  2. KM=1.0 mM for ATP1 Publication
  1. Vmax=2.0 µmol/min/mg enzyme1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: phosphatidylinositol metabolism

This protein is involved in the pathway phosphatidylinositol metabolism, which is part of Phospholipid metabolism.2 Publications
View all proteins of this organism that are known to be involved in the pathway phosphatidylinositol metabolism and in Phospholipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei220ATPBy similarity1
Binding sitei222SubstrateBy similarity1
Binding sitei383ATPBy similarity1
Binding sitei386SubstrateBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi207 – 209ATPBy similarity3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
Biological processLipid metabolism, Phospholipid metabolism
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS00942-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.4.21 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1855191 Synthesis of IPs in the nucleus
R-HSA-909733 Interferon alpha/beta signaling

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q9UHH9

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00949

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Inositol hexakisphosphate kinase 2 (EC:2.7.4.-2 Publications)
Short name:
InsP6 kinase 21 Publication
Short name:
InsP6K21 Publication
Alternative name(s):
P(i)-uptake stimulator
Short name:
PiUS1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IP6K21 Publication
Synonyms:IHPK2
ORF Names:TCCCIA00113
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000068745.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17313 IP6K2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606992 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UHH9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51447

Open Targets

More...
OpenTargetsi
ENSG00000068745

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164720999

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UHH9 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IP6K2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50400688

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000668771 – 426Inositol hexakisphosphate kinase 2Add BLAST426

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UHH9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UHH9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UHH9

PeptideAtlas

More...
PeptideAtlasi
Q9UHH9

PRoteomics IDEntifications database

More...
PRIDEi
Q9UHH9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
34267
84351 [Q9UHH9-1]
84352 [Q9UHH9-2]
84353 [Q9UHH9-3]
84354 [Q9UHH9-4]
84355 [Q9UHH9-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UHH9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UHH9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000068745 Expressed in right hemisphere of cerebellum and 214 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UHH9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UHH9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000068745 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
119546, 13 interactors

Database of interacting proteins

More...
DIPi
DIP-29676N

Protein interaction database and analysis system

More...
IntActi
Q9UHH9, 12 interactors

Molecular INTeraction database

More...
MINTi
Q9UHH9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000331103

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UHH9 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni236 – 243Substrate bindingBy similarity8

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1620 Eukaryota
ENOG410YB60 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156310

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_014862_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UHH9

KEGG Orthology (KO)

More...
KOi
K07756

Identification of Orthologs from Complete Genome Data

More...
OMAi
KQESYRF

Database of Orthologous Groups

More...
OrthoDBi
902814at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UHH9

TreeFam database of animal gene trees

More...
TreeFami
TF314066

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.510.50, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005522 IPK
IPR038286 IPK_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12400 PTHR12400, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03770 IPK, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UHH9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPAFRAMDV EPRAKGVLLE PFVHQVGGHS CVLRFNETTL CKPLVPREHQ
60 70 80 90 100
FYETLPAEMR KFTPQYKGVV SVRFEEDEDR NLCLIAYPLK GDHGIVDIVD
110 120 130 140 150
NSDCEPKSKL LRWTTNKKHH VLETEKTPKD WVRQHRKEEK MKSHKLEEEF
160 170 180 190 200
EWLKKSEVLY YTVEKKGNIS SQLKHYNPWS MKCHQQQLQR MKENAKHRNQ
210 220 230 240 250
YKFILLENLT SRYEVPCVLD LKMGTRQHGD DASEEKAANQ IRKCQQSTSA
260 270 280 290 300
VIGVRVCGMQ VYQAGSGQLM FMNKYHGRKL SVQGFKEALF QFFHNGRYLR
310 320 330 340 350
RELLGPVLKK LTELKAVLER QESYRFYSSS LLVIYDGKER PEVVLDSDAE
360 370 380 390 400
DLEDLSEESA DESAGAYAYK PIGASSVDVR MIDFAHTTCR LYGEDTVVHE
410 420
GQDAGYIFGL QSLIDIVTEI SEESGE
Length:426
Mass (Da):49,186
Last modified:July 19, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i11BDFF12C22EECFB
GO
Isoform 2 (identifier: Q9UHH9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-97: VVSVRFEEDEDRNLCLIAYPLKGDHGIVD → QSQRPLVSWPSLPHFFPWSFPLWPQGSVA
     98-426: Missing.

Show »
Length:97
Mass (Da):11,180
Checksum:i20CD12C8CB9E4287
GO
Isoform 3 (identifier: Q9UHH9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: V → S
     71-426: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:70
Mass (Da):8,004
Checksum:iB44FEE3FD8C14391
GO
Isoform 4 (identifier: Q9UHH9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSLNLPEASLLSRASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.

Show »
Length:185
Mass (Da):20,924
Checksum:iD52B5B42D42D1472
GO
Isoform 5 (identifier: Q9UHH9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNLCQSPFQEGCQSLLASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.

Show »
Length:188
Mass (Da):21,291
Checksum:i86D9872EAD7F79F6
GO
Isoform 6 (identifier: Q9UHH9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-87: VVSVRFEEDEDRNLCLIAY → DISSHQHGGVFVGEWGSLL
     88-426: Missing.

Show »
Length:87
Mass (Da):9,825
Checksum:i30E2F170A5B95C9B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J790C9J790_HUMAN
Kinase
IP6K2
95Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J536C9J536_HUMAN
Kinase
IP6K2
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JRM0C9JRM0_HUMAN
Kinase
IP6K2
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J124C9J124_HUMAN
Kinase
IP6K2
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3W9C9J3W9_HUMAN
Kinase
IP6K2
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8W6C9J8W6_HUMAN
Kinase
IP6K2
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGK2C9JGK2_HUMAN
Kinase
IP6K2
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JHX0C9JHX0_HUMAN
Kinase
IP6K2
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLG7C9JLG7_HUMAN
Kinase
IP6K2
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JMC9C9JMC9_HUMAN
Kinase
IP6K2
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti99 – 100VD → AH in AAF15057 (PubMed:10574768).Curated2
Sequence conflicti167G → W in AAH65533 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0426981M → MSLNLPEASLLSRASWPEQA KEPRREGHTDKQQTEDVLAA GLRCLPHLPAICARRM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0428451M → MNLCQSPFQEGCQSLLASWP EQAKEPRREGHTDKQQTEDV LAAGLRCLPHLPAICARRM in isoform 5. 1 Publication1
Alternative sequenceiVSP_04269969 – 130VVSVR…KTPKD → KSQLLEGLPHWRGDVRDRGH GRPWQPSLEPSLPPTLCFPS LSSFSSSWPSAQHLTPSVFN PW in isoform 4 and isoform 5. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_01092569 – 97VVSVR…HGIVD → QSQRPLVSWPSLPHFFPWSF PLWPQGSVA in isoform 2. 2 PublicationsAdd BLAST29
Alternative sequenceiVSP_04541669 – 87VVSVR…CLIAY → DISSHQHGGVFVGEWGSLL in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01092670V → S in isoform 3. 1 Publication1
Alternative sequenceiVSP_01092771 – 426Missing in isoform 3. 1 PublicationAdd BLAST356
Alternative sequenceiVSP_04541788 – 426Missing in isoform 6. 1 PublicationAdd BLAST339
Alternative sequenceiVSP_01092898 – 426Missing in isoform 2. 2 PublicationsAdd BLAST329
Alternative sequenceiVSP_042700131 – 426Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST296

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF177145 mRNA Translation: AAF15057.1
AY007091 mRNA Translation: AAG01984.1
AK290526 mRNA Translation: BAF83215.1
AK304714 mRNA Translation: BAG65478.1
AC141002 Genomic DNA No translation available.
BC001864 mRNA No translation available.
BC004469 mRNA Translation: AAH04469.2
BC019694 mRNA Translation: AAH19694.1
BC065533 mRNA Translation: AAH65533.1
CA488567 mRNA No translation available.
AL117458 mRNA Translation: CAB55936.1
AL137514 mRNA Translation: CAB70780.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2777.1 [Q9UHH9-1]
CCDS33752.1 [Q9UHH9-2]
CCDS54579.1 [Q9UHH9-6]
CCDS54580.1 [Q9UHH9-4]
CCDS54581.1 [Q9UHH9-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T17246
T46275

NCBI Reference Sequences

More...
RefSeqi
NP_001005909.1, NM_001005909.2 [Q9UHH9-1]
NP_001005910.1, NM_001005910.2 [Q9UHH9-2]
NP_001005911.1, NM_001005911.2 [Q9UHH9-2]
NP_001139650.1, NM_001146178.2 [Q9UHH9-6]
NP_001139651.1, NM_001146179.2 [Q9UHH9-6]
NP_001177245.1, NM_001190316.1 [Q9UHH9-4]
NP_001177246.1, NM_001190317.1 [Q9UHH9-5]
NP_057375.2, NM_016291.3 [Q9UHH9-1]
XP_011532124.1, XM_011533822.1 [Q9UHH9-6]
XP_011532125.1, XM_011533823.1 [Q9UHH9-6]
XP_016862072.1, XM_017006583.1 [Q9UHH9-1]
XP_016862073.1, XM_017006584.1 [Q9UHH9-1]
XP_016862074.1, XM_017006585.1 [Q9UHH9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000328631; ENSP00000331103; ENSG00000068745 [Q9UHH9-1]
ENST00000340879; ENSP00000341925; ENSG00000068745 [Q9UHH9-2]
ENST00000413298; ENSP00000396203; ENSG00000068745 [Q9UHH9-2]
ENST00000416707; ENSP00000387759; ENSG00000068745 [Q9UHH9-3]
ENST00000431721; ENSP00000414139; ENSG00000068745 [Q9UHH9-4]
ENST00000432678; ENSP00000400812; ENSG00000068745 [Q9UHH9-6]
ENST00000446860; ENSP00000399052; ENSG00000068745 [Q9UHH9-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51447

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51447

UCSC genome browser

More...
UCSCi
uc003cuq.4 human [Q9UHH9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF177145 mRNA Translation: AAF15057.1
AY007091 mRNA Translation: AAG01984.1
AK290526 mRNA Translation: BAF83215.1
AK304714 mRNA Translation: BAG65478.1
AC141002 Genomic DNA No translation available.
BC001864 mRNA No translation available.
BC004469 mRNA Translation: AAH04469.2
BC019694 mRNA Translation: AAH19694.1
BC065533 mRNA Translation: AAH65533.1
CA488567 mRNA No translation available.
AL117458 mRNA Translation: CAB55936.1
AL137514 mRNA Translation: CAB70780.1
CCDSiCCDS2777.1 [Q9UHH9-1]
CCDS33752.1 [Q9UHH9-2]
CCDS54579.1 [Q9UHH9-6]
CCDS54580.1 [Q9UHH9-4]
CCDS54581.1 [Q9UHH9-5]
PIRiT17246
T46275
RefSeqiNP_001005909.1, NM_001005909.2 [Q9UHH9-1]
NP_001005910.1, NM_001005910.2 [Q9UHH9-2]
NP_001005911.1, NM_001005911.2 [Q9UHH9-2]
NP_001139650.1, NM_001146178.2 [Q9UHH9-6]
NP_001139651.1, NM_001146179.2 [Q9UHH9-6]
NP_001177245.1, NM_001190316.1 [Q9UHH9-4]
NP_001177246.1, NM_001190317.1 [Q9UHH9-5]
NP_057375.2, NM_016291.3 [Q9UHH9-1]
XP_011532124.1, XM_011533822.1 [Q9UHH9-6]
XP_011532125.1, XM_011533823.1 [Q9UHH9-6]
XP_016862072.1, XM_017006583.1 [Q9UHH9-1]
XP_016862073.1, XM_017006584.1 [Q9UHH9-1]
XP_016862074.1, XM_017006585.1 [Q9UHH9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi119546, 13 interactors
DIPiDIP-29676N
IntActiQ9UHH9, 12 interactors
MINTiQ9UHH9
STRINGi9606.ENSP00000331103

PTM databases

iPTMnetiQ9UHH9
PhosphoSitePlusiQ9UHH9

Polymorphism and mutation databases

BioMutaiIP6K2
DMDMi50400688

Proteomic databases

EPDiQ9UHH9
MassIVEiQ9UHH9
PaxDbiQ9UHH9
PeptideAtlasiQ9UHH9
PRIDEiQ9UHH9
ProteomicsDBi34267
84351 [Q9UHH9-1]
84352 [Q9UHH9-2]
84353 [Q9UHH9-3]
84354 [Q9UHH9-4]
84355 [Q9UHH9-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1556 196 antibodies

The DNASU plasmid repository

More...
DNASUi
51447

Genome annotation databases

EnsembliENST00000328631; ENSP00000331103; ENSG00000068745 [Q9UHH9-1]
ENST00000340879; ENSP00000341925; ENSG00000068745 [Q9UHH9-2]
ENST00000413298; ENSP00000396203; ENSG00000068745 [Q9UHH9-2]
ENST00000416707; ENSP00000387759; ENSG00000068745 [Q9UHH9-3]
ENST00000431721; ENSP00000414139; ENSG00000068745 [Q9UHH9-4]
ENST00000432678; ENSP00000400812; ENSG00000068745 [Q9UHH9-6]
ENST00000446860; ENSP00000399052; ENSG00000068745 [Q9UHH9-5]
GeneIDi51447
KEGGihsa:51447
UCSCiuc003cuq.4 human [Q9UHH9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51447
DisGeNETi51447
EuPathDBiHostDB:ENSG00000068745.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IP6K2
HGNCiHGNC:17313 IP6K2
HPAiENSG00000068745 Low tissue specificity
MIMi606992 gene
neXtProtiNX_Q9UHH9
OpenTargetsiENSG00000068745
PharmGKBiPA164720999

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1620 Eukaryota
ENOG410YB60 LUCA
GeneTreeiENSGT00940000156310
HOGENOMiCLU_014862_0_0_1
InParanoidiQ9UHH9
KOiK07756
OMAiKQESYRF
OrthoDBi902814at2759
PhylomeDBiQ9UHH9
TreeFamiTF314066

Enzyme and pathway databases

UniPathwayiUPA00949
BioCyciMetaCyc:HS00942-MONOMER
BRENDAi2.7.4.21 2681
ReactomeiR-HSA-1855191 Synthesis of IPs in the nucleus
R-HSA-909733 Interferon alpha/beta signaling
SABIO-RKiQ9UHH9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
51447 4 hits in 791 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IP6K2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
IHPK2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51447
PharosiQ9UHH9 Tbio

Protein Ontology

More...
PROi
PR:Q9UHH9
RNActiQ9UHH9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000068745 Expressed in right hemisphere of cerebellum and 214 other tissues
ExpressionAtlasiQ9UHH9 baseline and differential
GenevisibleiQ9UHH9 HS

Family and domain databases

Gene3Di1.10.510.50, 1 hit
InterProiView protein in InterPro
IPR005522 IPK
IPR038286 IPK_sf
PANTHERiPTHR12400 PTHR12400, 1 hit
PfamiView protein in Pfam
PF03770 IPK, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIP6K2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UHH9
Secondary accession number(s): A8K3B1
, B4E3G6, G8JLL6, Q6P0N8, Q9BSZ6, Q9BUW3, Q9H4P7, Q9NT63, Q9UFU6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: June 17, 2020
This is version 160 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again