Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tachykinin-3

Gene

TAC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles (By similarity). Is a critical central regulator of gonadal function.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • neuromedin K receptor binding Source: UniProtKB
  • signaling receptor binding Source: ProtInc
  • substance K receptor binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionNeuropeptide

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-380095 Tachykinin receptors bind tachykinins
R-HSA-416476 G alpha (q) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tachykinin-3
Alternative name(s):
ZNEUROK1
Cleaved into the following chain:
Neurokinin-B
Short name:
NKB
Alternative name(s):
Neuromedin-K
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TAC3
Synonyms:NKNB
ORF Names:UNQ585/PRO1155
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000166863.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11521 TAC3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
162330 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UHF0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hypogonadotropic hypogonadism 10 with or without anosmia (HH10)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by absent or incomplete sexual maturation by the age of 18 years, in conjunction with low levels of circulating gonadotropins and testosterone and no other abnormalities of the hypothalamic-pituitary axis. In some cases, it is associated with non-reproductive phenotypes, such as anosmia, cleft palate, and sensorineural hearing loss. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In the presence of anosmia, idiopathic hypogonadotropic hypogonadism is referred to as Kallmann syndrome, whereas in the presence of a normal sense of smell, it has been termed normosmic idiopathic hypogonadotropic hypogonadism (nIHH).
See also OMIM:614839
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06996980R → S in HH10; phenotype consistent with normosmic idiopathic hypogonadotropic hypogonadism; the patient also carries a mutation in HS6ST1. 1 PublicationCorresponds to variant dbSNP:rs727505372EnsemblClinVar.1
Natural variantiVAR_06917690M → T in HH10; has markedly reduced activity. 1 PublicationCorresponds to variant dbSNP:rs121918123EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Hypogonadotropic hypogonadism

Organism-specific databases

DisGeNET

More...
DisGeNETi
6866

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
TAC3

MalaCards human disease database

More...
MalaCardsi
TAC3
MIMi614839 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000166863

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
432 Normosmic congenital hypogonadotropic hypogonadism

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36298

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3707470

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TAC3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
18203501

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 16Sequence analysisAdd BLAST16
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000003356517 – 78By similarityAdd BLAST62
<p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_000003356681 – 90Neurokinin-B10
PropeptideiPRO_000003356794 – 121By similarityAdd BLAST28

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei90Methionine amideBy similarity1

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UHF0

PeptideAtlas

More...
PeptideAtlasi
Q9UHF0

PRoteomics IDEntifications database

More...
PRIDEi
Q9UHF0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84336
84337 [Q9UHF0-2]
84338 [Q9UHF0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UHF0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UHF0

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q9UHF0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hypertension and pre-eclampsia.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000166863 Expressed in 120 organ(s), highest expression level in placenta

CleanEx database of gene expression profiles

More...
CleanExi
HS_TAC3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UHF0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UHF0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045919

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TACR3P293712EBI-6655626,EBI-6655576

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112729, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UHF0, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000300108

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9UHF0

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1121
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P9FNMR-A81-90[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UHF0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UHF0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UHF0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tachykinin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J2QH Eukaryota
ENOG4111D7S LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000335

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154597

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG016587

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UHF0

KEGG Orthology (KO)

More...
KOi
K05240

Identification of Orthologs from Complete Genome Data

More...
OMAi
AVCEESQ

Database of Orthologous Groups

More...
OrthoDBi
1552376at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UHF0

TreeFam database of animal gene trees

More...
TreeFami
TF337038

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003635 Neurokinin-B/TAC3
IPR013055 Tachy_Neuro_lke_CS

The PANTHER Classification System

More...
PANTHERi
PTHR15536 PTHR15536, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03823 Neurokinin_B, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001843 Neurokinin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01828 NEUROKININB

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00267 TACHYKININ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9UHF0-1) [UniParc]FASTAAdd to basket
Also known as: Beta tachykinin 3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRIMLLFTAI LAFSLAQSFG AVCKEPQEEV VPGGGRSKRD PDLYQLLQRL
60 70 80 90 100
FKSHSSLEGL LKALSQASTD PKESTSPEKR DMHDFFVGLM GKRSVQPDSP
110 120
TDVNQENVPS FGILKYPPRA E
Length:121
Mass (Da):13,438
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i14C9AFE2EE9EDECA
GO
Isoform 2 (identifier: Q9UHF0-2) [UniParc]FASTAAdd to basket
Also known as: Alpha tachykinin 3

The sequence of this isoform differs from the canonical sequence as follows:
     98-121: DSPTDVNQENVPSFGILKYPPRAE → EGKTGPFLPSVRVPRPLHPNQLGSTGKSSLGTEEQRPL

Show »
Length:135
Mass (Da):14,833
Checksum:i4C6DBBDBE30851F3
GO
Isoform 3 (identifier: Q9UHF0-3) [UniParc]FASTAAdd to basket
Also known as: Gamma tachykinin 3

The sequence of this isoform differs from the canonical sequence as follows:
     80-98: RDMHDFFVGLMGKRSVQPD → H

Show »
Length:103
Mass (Da):11,358
Checksum:i2D0026B586B03FC6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti121E → D in CAG33474 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06996980R → S in HH10; phenotype consistent with normosmic idiopathic hypogonadotropic hypogonadism; the patient also carries a mutation in HS6ST1. 1 PublicationCorresponds to variant dbSNP:rs727505372EnsemblClinVar.1
Natural variantiVAR_06917690M → T in HH10; has markedly reduced activity. 1 PublicationCorresponds to variant dbSNP:rs121918123EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01318680 – 98RDMHD…SVQPD → H in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01318798 – 121DSPTD…PPRAE → EGKTGPFLPSVRVPRPLHPN QLGSTGKSSLGTEEQRPL in isoform 2. 2 PublicationsAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF186112 mRNA Translation: AAF01430.1
AF216586 mRNA Translation: AAF76980.1
AF537113 mRNA Translation: AAQ10783.1
AF537114 mRNA Translation: AAQ10784.1
AF537115 mRNA Translation: AAQ10785.1
AF537116 mRNA Translation: AAQ10786.1
AF537117 mRNA Translation: AAQ10787.1
AF537118 mRNA Translation: AAQ10788.1
AF537119 mRNA Translation: AAQ10789.1
AF537120 mRNA Translation: AAQ10790.1
AF537121 mRNA Translation: AAQ10791.1
AY358679 mRNA Translation: AAQ89042.1
CR457193 mRNA Translation: CAG33474.1
BC032145 mRNA Translation: AAH32145.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53803.1 [Q9UHF0-3]
CCDS8928.1 [Q9UHF0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001171525.1, NM_001178054.1 [Q9UHF0-3]
NP_037383.1, NM_013251.3 [Q9UHF0-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.9730

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000300108; ENSP00000300108; ENSG00000166863 [Q9UHF0-1]
ENST00000357616; ENSP00000350236; ENSG00000166863 [Q9UHF0-2]
ENST00000379411; ENSP00000368721; ENSG00000166863 [Q9UHF0-3]
ENST00000393867; ENSP00000377445; ENSG00000166863 [Q9UHF0-2]
ENST00000415231; ENSP00000402995; ENSG00000166863 [Q9UHF0-1]
ENST00000423597; ENSP00000416292; ENSG00000166863 [Q9UHF0-3]
ENST00000438756; ENSP00000408131; ENSG00000166863 [Q9UHF0-2]
ENST00000441881; ENSP00000408208; ENSG00000166863 [Q9UHF0-3]
ENST00000458521; ENSP00000404056; ENSG00000166863 [Q9UHF0-1]
ENST00000615887; ENSP00000483110; ENSG00000166863 [Q9UHF0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6866

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6866

UCSC genome browser

More...
UCSCi
uc001smo.4 human [Q9UHF0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF186112 mRNA Translation: AAF01430.1
AF216586 mRNA Translation: AAF76980.1
AF537113 mRNA Translation: AAQ10783.1
AF537114 mRNA Translation: AAQ10784.1
AF537115 mRNA Translation: AAQ10785.1
AF537116 mRNA Translation: AAQ10786.1
AF537117 mRNA Translation: AAQ10787.1
AF537118 mRNA Translation: AAQ10788.1
AF537119 mRNA Translation: AAQ10789.1
AF537120 mRNA Translation: AAQ10790.1
AF537121 mRNA Translation: AAQ10791.1
AY358679 mRNA Translation: AAQ89042.1
CR457193 mRNA Translation: CAG33474.1
BC032145 mRNA Translation: AAH32145.1
CCDSiCCDS53803.1 [Q9UHF0-3]
CCDS8928.1 [Q9UHF0-1]
RefSeqiNP_001171525.1, NM_001178054.1 [Q9UHF0-3]
NP_037383.1, NM_013251.3 [Q9UHF0-1]
UniGeneiHs.9730

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P9FNMR-A81-90[»]
ProteinModelPortaliQ9UHF0
SMRiQ9UHF0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112729, 10 interactors
IntActiQ9UHF0, 9 interactors
STRINGi9606.ENSP00000300108

Chemistry databases

BindingDBiQ9UHF0
ChEMBLiCHEMBL3707470

PTM databases

iPTMnetiQ9UHF0
PhosphoSitePlusiQ9UHF0

Polymorphism and mutation databases

BioMutaiTAC3
DMDMi18203501

Proteomic databases

PaxDbiQ9UHF0
PeptideAtlasiQ9UHF0
PRIDEiQ9UHF0
ProteomicsDBi84336
84337 [Q9UHF0-2]
84338 [Q9UHF0-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6866
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300108; ENSP00000300108; ENSG00000166863 [Q9UHF0-1]
ENST00000357616; ENSP00000350236; ENSG00000166863 [Q9UHF0-2]
ENST00000379411; ENSP00000368721; ENSG00000166863 [Q9UHF0-3]
ENST00000393867; ENSP00000377445; ENSG00000166863 [Q9UHF0-2]
ENST00000415231; ENSP00000402995; ENSG00000166863 [Q9UHF0-1]
ENST00000423597; ENSP00000416292; ENSG00000166863 [Q9UHF0-3]
ENST00000438756; ENSP00000408131; ENSG00000166863 [Q9UHF0-2]
ENST00000441881; ENSP00000408208; ENSG00000166863 [Q9UHF0-3]
ENST00000458521; ENSP00000404056; ENSG00000166863 [Q9UHF0-1]
ENST00000615887; ENSP00000483110; ENSG00000166863 [Q9UHF0-1]
GeneIDi6866
KEGGihsa:6866
UCSCiuc001smo.4 human [Q9UHF0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6866
DisGeNETi6866
EuPathDBiHostDB:ENSG00000166863.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TAC3
GeneReviewsiTAC3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0010742
HGNCiHGNC:11521 TAC3
HPAiHPA045919
MalaCardsiTAC3
MIMi162330 gene
614839 phenotype
neXtProtiNX_Q9UHF0
OpenTargetsiENSG00000166863
Orphaneti432 Normosmic congenital hypogonadotropic hypogonadism
PharmGKBiPA36298

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J2QH Eukaryota
ENOG4111D7S LUCA
GeneTreeiENSGT00390000000335
HOGENOMiHOG000154597
HOVERGENiHBG016587
InParanoidiQ9UHF0
KOiK05240
OMAiAVCEESQ
OrthoDBi1552376at2759
PhylomeDBiQ9UHF0
TreeFamiTF337038

Enzyme and pathway databases

ReactomeiR-HSA-380095 Tachykinin receptors bind tachykinins
R-HSA-416476 G alpha (q) signalling events

Miscellaneous databases

EvolutionaryTraceiQ9UHF0

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TAC3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6866
PMAP-CutDBiQ9UHF0

Protein Ontology

More...
PROi
PR:Q9UHF0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000166863 Expressed in 120 organ(s), highest expression level in placenta
CleanExiHS_TAC3
ExpressionAtlasiQ9UHF0 baseline and differential
GenevisibleiQ9UHF0 HS

Family and domain databases

InterProiView protein in InterPro
IPR003635 Neurokinin-B/TAC3
IPR013055 Tachy_Neuro_lke_CS
PANTHERiPTHR15536 PTHR15536, 1 hit
PfamiView protein in Pfam
PF03823 Neurokinin_B, 1 hit
PIRSFiPIRSF001843 Neurokinin, 1 hit
PRINTSiPR01828 NEUROKININB
PROSITEiView protein in PROSITE
PS00267 TACHYKININ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTKNK_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UHF0
Secondary accession number(s): Q6IAG2, Q71BC6, Q71BC9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: May 1, 2000
Last modified: January 16, 2019
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again