Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tachykinin-3

Gene

TAC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles (By similarity). Is a critical central regulator of gonadal function.By similarity1 Publication

GO - Molecular functioni

  • neuromedin K receptor binding Source: UniProtKB
  • signaling receptor binding Source: ProtInc
  • substance K receptor binding Source: UniProtKB

GO - Biological processi

  • female pregnancy Source: ProtInc
  • G-protein coupled receptor signaling pathway Source: Reactome
  • neuropeptide signaling pathway Source: UniProtKB-KW
  • positive regulation of flagellated sperm motility Source: UniProtKB
  • tachykinin receptor signaling pathway Source: ProtInc

Keywordsi

Molecular functionNeuropeptide

Enzyme and pathway databases

ReactomeiR-HSA-380095 Tachykinin receptors bind tachykinins
R-HSA-416476 G alpha (q) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Tachykinin-3
Alternative name(s):
ZNEUROK1
Cleaved into the following chain:
Neurokinin-B
Short name:
NKB
Alternative name(s):
Neuromedin-K
Gene namesi
Name:TAC3
Synonyms:NKNB
ORF Names:UNQ585/PRO1155
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000166863.11
HGNCiHGNC:11521 TAC3
MIMi162330 gene
neXtProtiNX_Q9UHF0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Hypogonadotropic hypogonadism 10 with or without anosmia (HH10)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by absent or incomplete sexual maturation by the age of 18 years, in conjunction with low levels of circulating gonadotropins and testosterone and no other abnormalities of the hypothalamic-pituitary axis. In some cases, it is associated with non-reproductive phenotypes, such as anosmia, cleft palate, and sensorineural hearing loss. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In the presence of anosmia, idiopathic hypogonadotropic hypogonadism is referred to as Kallmann syndrome, whereas in the presence of a normal sense of smell, it has been termed normosmic idiopathic hypogonadotropic hypogonadism (nIHH).
See also OMIM:614839
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06996980R → S in HH10; phenotype consistent with normosmic idiopathic hypogonadotropic hypogonadism; the patient also carries a mutation in HS6ST1. 1 PublicationCorresponds to variant dbSNP:rs727505372EnsemblClinVar.1
Natural variantiVAR_06917690M → T in HH10; has markedly reduced activity. 1 PublicationCorresponds to variant dbSNP:rs121918123EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Hypogonadotropic hypogonadism

Organism-specific databases

DisGeNETi6866
MalaCardsiTAC3
MIMi614839 phenotype
OpenTargetsiENSG00000166863
Orphaneti432 Normosmic congenital hypogonadotropic hypogonadism
PharmGKBiPA36298

Chemistry databases

ChEMBLiCHEMBL3707470

Polymorphism and mutation databases

BioMutaiTAC3
DMDMi18203501

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
PropeptideiPRO_000003356517 – 78By similarityAdd BLAST62
PeptideiPRO_000003356681 – 90Neurokinin-B10
PropeptideiPRO_000003356794 – 121By similarityAdd BLAST28

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei90Methionine amideBy similarity1

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDbiQ9UHF0
PeptideAtlasiQ9UHF0
PRIDEiQ9UHF0
ProteomicsDBi84336
84337 [Q9UHF0-2]
84338 [Q9UHF0-3]

PTM databases

iPTMnetiQ9UHF0
PhosphoSitePlusiQ9UHF0

Miscellaneous databases

PMAP-CutDBiQ9UHF0

Expressioni

Developmental stagei

In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hypertension and pre-eclampsia.

Gene expression databases

BgeeiENSG00000166863
CleanExiHS_TAC3
ExpressionAtlasiQ9UHF0 baseline and differential
GenevisibleiQ9UHF0 HS

Organism-specific databases

HPAiHPA045919

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TACR3P293712EBI-6655626,EBI-6655576

GO - Molecular functioni

  • neuromedin K receptor binding Source: UniProtKB
  • signaling receptor binding Source: ProtInc
  • substance K receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi112729, 10 interactors
IntActiQ9UHF0, 9 interactors
STRINGi9606.ENSP00000300108

Chemistry databases

BindingDBiQ9UHF0

Structurei

Secondary structure

1121
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi82 – 89Combined sources8

3D structure databases

ProteinModelPortaliQ9UHF0
SMRiQ9UHF0
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UHF0

Family & Domainsi

Sequence similaritiesi

Belongs to the tachykinin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J2QH Eukaryota
ENOG4111D7S LUCA
GeneTreeiENSGT00390000000335
HOGENOMiHOG000154597
HOVERGENiHBG016587
InParanoidiQ9UHF0
KOiK05240
OMAiAVCEESQ
OrthoDBiEOG091G0X8Y
PhylomeDBiQ9UHF0
TreeFamiTF337038

Family and domain databases

InterProiView protein in InterPro
IPR003635 Neurokinin-B/TAC3
IPR013055 Tachy_Neuro_lke_CS
PANTHERiPTHR15536 PTHR15536, 1 hit
PfamiView protein in Pfam
PF03823 Neurokinin_B, 1 hit
PIRSFiPIRSF001843 Neurokinin, 1 hit
PRINTSiPR01828 NEUROKININB
PROSITEiView protein in PROSITE
PS00267 TACHYKININ, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UHF0-1) [UniParc]FASTAAdd to basket
Also known as: Beta tachykinin 3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRIMLLFTAI LAFSLAQSFG AVCKEPQEEV VPGGGRSKRD PDLYQLLQRL
60 70 80 90 100
FKSHSSLEGL LKALSQASTD PKESTSPEKR DMHDFFVGLM GKRSVQPDSP
110 120
TDVNQENVPS FGILKYPPRA E
Length:121
Mass (Da):13,438
Last modified:May 1, 2000 - v1
Checksum:i14C9AFE2EE9EDECA
GO
Isoform 2 (identifier: Q9UHF0-2) [UniParc]FASTAAdd to basket
Also known as: Alpha tachykinin 3

The sequence of this isoform differs from the canonical sequence as follows:
     98-121: DSPTDVNQENVPSFGILKYPPRAE → EGKTGPFLPSVRVPRPLHPNQLGSTGKSSLGTEEQRPL

Show »
Length:135
Mass (Da):14,833
Checksum:i4C6DBBDBE30851F3
GO
Isoform 3 (identifier: Q9UHF0-3) [UniParc]FASTAAdd to basket
Also known as: Gamma tachykinin 3

The sequence of this isoform differs from the canonical sequence as follows:
     80-98: RDMHDFFVGLMGKRSVQPD → H

Show »
Length:103
Mass (Da):11,358
Checksum:i2D0026B586B03FC6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti121E → D in CAG33474 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06996980R → S in HH10; phenotype consistent with normosmic idiopathic hypogonadotropic hypogonadism; the patient also carries a mutation in HS6ST1. 1 PublicationCorresponds to variant dbSNP:rs727505372EnsemblClinVar.1
Natural variantiVAR_06917690M → T in HH10; has markedly reduced activity. 1 PublicationCorresponds to variant dbSNP:rs121918123EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01318680 – 98RDMHD…SVQPD → H in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01318798 – 121DSPTD…PPRAE → EGKTGPFLPSVRVPRPLHPN QLGSTGKSSLGTEEQRPL in isoform 2. 2 PublicationsAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF186112 mRNA Translation: AAF01430.1
AF216586 mRNA Translation: AAF76980.1
AF537113 mRNA Translation: AAQ10783.1
AF537114 mRNA Translation: AAQ10784.1
AF537115 mRNA Translation: AAQ10785.1
AF537116 mRNA Translation: AAQ10786.1
AF537117 mRNA Translation: AAQ10787.1
AF537118 mRNA Translation: AAQ10788.1
AF537119 mRNA Translation: AAQ10789.1
AF537120 mRNA Translation: AAQ10790.1
AF537121 mRNA Translation: AAQ10791.1
AY358679 mRNA Translation: AAQ89042.1
CR457193 mRNA Translation: CAG33474.1
BC032145 mRNA Translation: AAH32145.1
CCDSiCCDS53803.1 [Q9UHF0-3]
CCDS8928.1 [Q9UHF0-1]
RefSeqiNP_001171525.1, NM_001178054.1 [Q9UHF0-3]
NP_037383.1, NM_013251.3 [Q9UHF0-1]
UniGeneiHs.9730

Genome annotation databases

EnsembliENST00000300108; ENSP00000300108; ENSG00000166863 [Q9UHF0-1]
ENST00000357616; ENSP00000350236; ENSG00000166863 [Q9UHF0-2]
ENST00000379411; ENSP00000368721; ENSG00000166863 [Q9UHF0-3]
ENST00000393867; ENSP00000377445; ENSG00000166863 [Q9UHF0-2]
ENST00000415231; ENSP00000402995; ENSG00000166863 [Q9UHF0-1]
ENST00000423597; ENSP00000416292; ENSG00000166863 [Q9UHF0-3]
ENST00000438756; ENSP00000408131; ENSG00000166863 [Q9UHF0-2]
ENST00000441881; ENSP00000408208; ENSG00000166863 [Q9UHF0-3]
ENST00000458521; ENSP00000404056; ENSG00000166863 [Q9UHF0-1]
ENST00000615887; ENSP00000483110; ENSG00000166863 [Q9UHF0-1]
GeneIDi6866
KEGGihsa:6866
UCSCiuc001smo.4 human [Q9UHF0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTKNK_HUMAN
AccessioniPrimary (citable) accession number: Q9UHF0
Secondary accession number(s): Q6IAG2, Q71BC6, Q71BC9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: May 1, 2000
Last modified: July 18, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health