Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (10 Apr 2019)
Sequence version 2 (01 May 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Interleukin-19

Gene

IL19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine
Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8854691 Interleukin-20 family signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9UHD0

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UHD0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-19
Short name:
IL-19
Alternative name(s):
Melanoma differentiation-associated protein-like protein
NG.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL19
Synonyms:ZMDA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000142224.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:5990 IL19

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605687 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UHD0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
29949

Open Targets

More...
OpenTargetsi
ENSG00000142224

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29806

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IL19

Domain mapping of disease mutations (DMDM)

More...
DMDMi
146345440

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 241 PublicationAdd BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001537925 – 177Interleukin-19Add BLAST153

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi28 ↔ 1211 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi56N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi75 ↔ 1271 Publication
Disulfide bondi76 ↔ 1291 Publication
Glycosylationi135N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UHD0

PeptideAtlas

More...
PeptideAtlasi
Q9UHD0

PRoteomics IDEntifications database

More...
PRIDEi
Q9UHD0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84320

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000142224 Expressed in 50 organ(s), highest expression level in nasal cavity epithelium

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UHD0 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9UHD0, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000343000

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1177
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1N1FX-ray1.95A19-177[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UHD0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UHD0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UHD0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the IL-10 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IWQW Eukaryota
ENOG41115RG LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183124

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113033

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108002

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UHD0

KEGG Orthology (KO)

More...
KOi
K05444

Identification of Orthologs from Complete Genome Data

More...
OMAi
CCMTKNL

Database of Orthologous Groups

More...
OrthoDBi
1267998at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UHD0

TreeFam database of animal gene trees

More...
TreeFami
TF333253

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009079 4_helix_cytokine-like_core
IPR020443 IL-10/19/20/22/24/26_fam
IPR020423 IL-10_CS
IPR020421 IL-19

The PANTHER Classification System

More...
PANTHERi
PTHR45406 PTHR45406, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00726 IL10, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01934 INTRLEUKIN19

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47266 SSF47266, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00520 INTERLEUKIN_10, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9UHD0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLQCVSLWL LGTILILCSV DNHGLRRCLI STDMHHIEES FQEIKRAIQA
60 70 80 90 100
KDTFPNVTIL STLETLQIIK PLDVCCVTKN LLAFYVDRVF KDHQEPNPKI
110 120 130 140 150
LRKISSIANS FLYMQKTLRQ CQEQRQCHCR QEATNATRVI HDNYDQLEVH
160 170
AAAIKSLGEL DVFLAWINKN HEVMFSA
Length:177
Mass (Da):20,452
Last modified:May 1, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7CCFB052177DE408
GO
Isoform 2 (identifier: Q9UHD0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM

Show »
Length:215
Mass (Da):24,568
Checksum:iD79D6B0F11DA74E4
GO
Isoform 3 (identifier: Q9UHD0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-177: QEQRQCHCRQ...NKNHEVMFSA → VSHWVRIPAS...GVTNLCQHIP

Show »
Length:207
Mass (Da):23,079
Checksum:iAFDEA5767BFF9784
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_013077175F → S4 PublicationsCorresponds to variant dbSNP:rs2243191Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0462531M → MCTEGAFPHRSACSLPLTHV HTHIHVCVPVLWGSVPRGM in isoform 2. 1 Publication1
Alternative sequenceiVSP_057193122 – 177QEQRQ…VMFSA → VSHWVRIPASAPCLPKERPG SAGPHRPPDMVLGVKGNSLR TSTGRTVENLSQWPLLPQGS LPADNSSDGLLLDNPPGVTN LCQHIP in isoform 3. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF276915 Genomic DNA Translation: AAG16755.1
AY040367 mRNA Translation: AAK91776.1
AF453946 mRNA Translation: AAN40906.1
FJ380053 mRNA Translation: ACJ06540.1
AF192498 mRNA Translation: AAF06663.1
AF390905 Genomic DNA Translation: AAK64498.1
AL513315 Genomic DNA No translation available.
AL049615 Genomic DNA Translation: CAB72342.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1468.1 [Q9UHD0-2]
CCDS1469.1 [Q9UHD0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_037503.2, NM_013371.3 [Q9UHD0-1]
NP_715639.1, NM_153758.2 [Q9UHD0-2]
XP_011507752.1, XM_011509450.2 [Q9UHD0-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.661017

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000270218; ENSP00000270218; ENSG00000142224 [Q9UHD0-1]
ENST00000340758; ENSP00000343000; ENSG00000142224 [Q9UHD0-2]
ENST00000620365; ENSP00000482668; ENSG00000142224 [Q9UHD0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29949

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29949

UCSC genome browser

More...
UCSCi
uc001heo.3 human [Q9UHD0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF276915 Genomic DNA Translation: AAG16755.1
AY040367 mRNA Translation: AAK91776.1
AF453946 mRNA Translation: AAN40906.1
FJ380053 mRNA Translation: ACJ06540.1
AF192498 mRNA Translation: AAF06663.1
AF390905 Genomic DNA Translation: AAK64498.1
AL513315 Genomic DNA No translation available.
AL049615 Genomic DNA Translation: CAB72342.1
CCDSiCCDS1468.1 [Q9UHD0-2]
CCDS1469.1 [Q9UHD0-1]
RefSeqiNP_037503.2, NM_013371.3 [Q9UHD0-1]
NP_715639.1, NM_153758.2 [Q9UHD0-2]
XP_011507752.1, XM_011509450.2 [Q9UHD0-3]
UniGeneiHs.661017

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1N1FX-ray1.95A19-177[»]
ProteinModelPortaliQ9UHD0
SMRiQ9UHD0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9UHD0, 2 interactors
STRINGi9606.ENSP00000343000

Polymorphism and mutation databases

BioMutaiIL19
DMDMi146345440

Proteomic databases

PaxDbiQ9UHD0
PeptideAtlasiQ9UHD0
PRIDEiQ9UHD0
ProteomicsDBi84320

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
29949
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000270218; ENSP00000270218; ENSG00000142224 [Q9UHD0-1]
ENST00000340758; ENSP00000343000; ENSG00000142224 [Q9UHD0-2]
ENST00000620365; ENSP00000482668; ENSG00000142224 [Q9UHD0-1]
GeneIDi29949
KEGGihsa:29949
UCSCiuc001heo.3 human [Q9UHD0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29949
DisGeNETi29949
EuPathDBiHostDB:ENSG00000142224.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IL19

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0200025
HGNCiHGNC:5990 IL19
MIMi605687 gene
neXtProtiNX_Q9UHD0
OpenTargetsiENSG00000142224
PharmGKBiPA29806

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IWQW Eukaryota
ENOG41115RG LUCA
GeneTreeiENSGT00950000183124
HOGENOMiHOG000113033
HOVERGENiHBG108002
InParanoidiQ9UHD0
KOiK05444
OMAiCCMTKNL
OrthoDBi1267998at2759
PhylomeDBiQ9UHD0
TreeFamiTF333253

Enzyme and pathway databases

ReactomeiR-HSA-8854691 Interleukin-20 family signaling
SignaLinkiQ9UHD0
SIGNORiQ9UHD0

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IL19 human
EvolutionaryTraceiQ9UHD0

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29949

Protein Ontology

More...
PROi
PR:Q9UHD0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000142224 Expressed in 50 organ(s), highest expression level in nasal cavity epithelium
GenevisibleiQ9UHD0 HS

Family and domain databases

InterProiView protein in InterPro
IPR009079 4_helix_cytokine-like_core
IPR020443 IL-10/19/20/22/24/26_fam
IPR020423 IL-10_CS
IPR020421 IL-19
PANTHERiPTHR45406 PTHR45406, 1 hit
PfamiView protein in Pfam
PF00726 IL10, 1 hit
PRINTSiPR01934 INTRLEUKIN19
SUPFAMiSSF47266 SSF47266, 1 hit
PROSITEiView protein in PROSITE
PS00520 INTERLEUKIN_10, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL19_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UHD0
Secondary accession number(s): B6VEV9
, Q5VUT3, Q96QR4, Q9NUA0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2007
Last modified: April 10, 2019
This is version 157 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again