Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (18 Sep 2019)
Sequence version 3 (25 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

SUN domain-containing protein 2

Gene

SUN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. Specifically, SYNE2 and SUN2 assemble in arrays of transmembrane actin-associated nuclear (TAN) lines which are bound to F-actin cables and couple the nucleus to retrograde actin flow during actin-dependent nuclear movement. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Required for nuclear migration in retinal photoreceptor progenitors implicating association with cytoplasmic dynein-dynactin and kinesin motor complexes, and probably B-type lamins; SUN1 and SUN2 seem to act redundantly. The SUN1/2:KASH5 LINC complex couples telomeres to microtubules during meiosis; SUN1 and SUN2 seem to act at least partial redundantly. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. May also function on endocytic vesicles as a receptor for RAB5-GDP and participate in the activation of RAB5.By similarityCurated1 Publication

Caution

It is uncertain whether Met-1 or Met-50 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • identical protein binding Source: IntAct
  • lamin binding Source: UniProtKB
  • microtubule binding Source: UniProtKB
  • protein membrane anchor Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processMeiosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1221632 Meiotic synapsis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SUN domain-containing protein 2
Alternative name(s):
Protein unc-84 homolog B
Rab5-interacting protein
Short name:
Rab5IP
Sad1/unc-84 protein-like 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SUN2
Synonyms:FRIGG, KIAA0668, RAB5IP, UNC84B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14210 SUN2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613569 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UH99

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 212Nuclear1 PublicationAdd BLAST212
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei213 – 233HelicalAdd BLAST21
Topological domaini234 – 717Perinuclear space1 PublicationAdd BLAST484

Keywords - Cellular componenti

Endosome, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi536L → D: Disrupts interaction with SYNE2. 1 Publication1
Mutagenesisi538Missing : Disrupts interaction with SYNE2. 1 Publication1
Mutagenesisi542D → N: Disrupts interaction with SYNE2. 2 Publications1
Mutagenesisi563C → A: Decreases stability of the SUN2:SYNE2/KASH2 complex under tensile forces and inhibits force transmission through the complex. 1 Publication1
Mutagenesisi603A → E: Decreases interaction with SYNE2. Disrupts interaction with SYNE2; when associated with E-641 and E-703. 1 Publication1
Mutagenesisi609G → D: Decreases interaction with SYNE2. 1 Publication1
Mutagenesisi628H → A: Disrupts interaction with SYNE2. 1 Publication1
Mutagenesisi641S → E: Decreases interaction with SYNE2. Disrupts interaction with SYNE2; when associated with E-603 and E-703. 2 Publications1
Mutagenesisi703Y → E: Decreases interaction with SYNE2. Disrupts interaction with SYNE2; when associated with E-603 and E-641. 1 Publication1
Mutagenesisi707Y → F: Disrupts interaction with SYNE2, impairs localization to the nuclear envelope. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
25777

Open Targets

More...
OpenTargetsi
ENSG00000100242

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165378369

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SUN2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
29337242

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002189131 – 717SUN domain-containing protein 2Add BLAST717

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei12Phosphoserine1 Publication1
Modified residuei38PhosphoserineCombined sources1
Modified residuei54PhosphoserineCombined sources1 Publication1
Modified residuei107PhosphothreonineBy similarity1
Modified residuei110PhosphoserineBy similarity1
Modified residuei113PhosphoserineBy similarity1
Modified residuei116Phosphoserine1 Publication1
Modified residuei136PhosphoserineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi563Interchain (with C-6862 in SYNE2)1 Publication
Disulfide bondi601 ↔ 7052 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi636N-linked (GlcNAc...) asparagine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The disulfid bond with SYNE2 is required for stability of the SUN2:SYNE2/KASH2 LINC complex under tensile forces though not required for the interaction. The disulfid bond is proposed to be conserved in LINC complexes involved in force transmission.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UH99

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UH99

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UH99

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UH99

PeptideAtlas

More...
PeptideAtlasi
Q9UH99

PRoteomics IDEntifications database

More...
PRIDEi
Q9UH99

ProteomicsDB human proteome resource

More...
ProteomicsDBi
2587
84289 [Q9UH99-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1777

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UH99

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UH99

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9UH99

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highly expressed in heart, lung and muscle. Weakly expressed in fetal heart. Slightly overexpressed in some heart tissues form patients with congenital heart defects.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100242 Expressed in 232 organ(s), highest expression level in popliteal artery

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UH99 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UH99 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001209

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Core component of the LINC complex which is composed of inner nuclear membrane SUN domain-containing proteins coupled to outer nuclear membrane KASH domain-containing nesprins. SUN and KASH domain-containing proteins seem to bind each other promiscuously; however, differentially expression of LINC complex constituents is giving rise to specific assemblies. At least SUN1/2-containing core LINC complexes are proposed to be hexameric composed of three protomers of each KASH and SUN domain-containing protein.

Interacts with SYNE2; the SUN2:SYNE2/KASH2 LINC complex is a heterohexamer; the homotrimeric cloverleave-like conformation of the SUN domain is a prerequisite for LINC complex formation in which three separate SYNE2/KASH2 peptides bind at the interface of adjacent SUN domains.

Component of a probable SUN2:KASH5 LINC complex.

Interacts with SYNE1 and SYNE3; probably forming respective LINC complexes.

Interacts with A-type lamin. Interaction with lamins B1 and C is hardly detectable (By similarity).

Interacts with EMD and RAB5A.

Interacts with TMEM43 and TMEM201.

By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117312, 66 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UH99, 91 interactors

Molecular INTeraction database

More...
MINTi
Q9UH99

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000385616

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1717
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UH99

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini555 – 716SUNPROSITE-ProRule annotationAdd BLAST162

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 139LMNA-bindingBy similarityAdd BLAST139
Regioni507 – 717Sufficient for interaction with SYNE1 and SYNE21 PublicationAdd BLAST211

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili273 – 296Sequence analysisAdd BLAST24
Coiled coili348 – 440Sequence analysisAdd BLAST93
Coiled coili475 – 506Sequence analysisAdd BLAST32

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi2 – 164Ser-richAdd BLAST163
Compositional biasi100 – 105Poly-Arg6
Compositional biasi316 – 322Poly-Gly7
Compositional biasi468 – 471Poly-Gly4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The coiled coil domains differentially mediate trimerization required for binding to nesprins and are proposed to dynamically regulate the oligomeric state by locking the SUN domain in an inactive confirmation (By similarity). The coiled coil domains are proposed to be involved in load-bearing and force transmission from the cytoskeleton.By similarity1 Publication
The SUN domain may play a role in the nuclear anchoring and/or migration.

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2687 Eukaryota
ENOG410YM6S LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160024

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000253025

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UH99

KEGG Orthology (KO)

More...
KOi
K19347

Identification of Orthologs from Complete Genome Data

More...
OMAi
GLLYWWV

Database of Orthologous Groups

More...
OrthoDBi
1000585at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UH99

TreeFam database of animal gene trees

More...
TreeFami
TF323915

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.260, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008979 Galactose-bd-like_sf
IPR030272 SUN2
IPR040994 Sun_CC2
IPR012919 SUN_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12911:SF22 PTHR12911:SF22, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07738 Sad1_UNC, 1 hit
PF18580 Sun2_CC2, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51469 SUN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UH99-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRRSQRLTR YSQGDDDGSS SSGGSSVAGS QSTLFKDSPL RTLKRKSSNM
60 70 80 90 100
KRLSPAPQLG PSSDAHTSYY SESLVHESWF PPRSSLEELH GDANWGEDLR
110 120 130 140 150
VRRRRGTGGS ESSRASGLVG RKATEDFLGS SSGYSSEDDY VGYSDVDQQS
160 170 180 190 200
SSSRLRSAVS RAGSLLWMVA TSPGRLFRLL YWWAGTTWYR LTTAASLLDV
210 220 230 240 250
FVLTRRFSSL KTFLWFLLPL LLLTCLTYGA WYFYPYGLQT FHPALVSWWA
260 270 280 290 300
AKDSRRPDEG WEARDSSPHF QAEQRVMSRV HSLERRLEAL AAEFSSNWQK
310 320 330 340 350
EAMRLERLEL RQGAPGQGGG GGLSHEDTLA LLEGLVSRRE AALKEDFRRE
360 370 380 390 400
TAARIQEELS ALRAEHQQDS EDLFKKIVRA SQESEARIQQ LKSEWQSMTQ
410 420 430 440 450
ESFQESSVKE LRRLEDQLAG LQQELAALAL KQSSVAEEVG LLPQQIQAVR
460 470 480 490 500
DDVESQFPAW ISQFLARGGG GRVGLLQREE MQAQLRELES KILTHVAEMQ
510 520 530 540 550
GKSAREAAAS LSLTLQKEGV IGVTEEQVHH IVKQALQRYS EDRIGLADYA
560 570 580 590 600
LESGGASVIS TRCSETYETK TALLSLFGIP LWYHSQSPRV ILQPDVHPGN
610 620 630 640 650
CWAFQGPQGF AVVRLSARIR PTAVTLEHVP KALSPNSTIS SAPKDFAIFG
660 670 680 690 700
FDEDLQQEGT LLGKFTYDQD GEPIQTFHFQ APTMATYQVV ELRILTNWGH
710
PEYTCIYRFR VHGEPAH
Length:717
Mass (Da):80,311
Last modified:March 25, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCCF43C118E935E84
GO
Isoform 2 (identifier: Q9UH99-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-141: V → VEDSEGRGSKVTETEPVSSFPA

Note: No experimental confirmation available.
Show »
Length:738
Mass (Da):82,502
Checksum:iBD17ECBB9F58069B
GO
Isoform 3 (identifier: Q9UH99-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     683-717: TMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH → SSFPLCPWRLLPILGVCIYVAYHGGLGSWER

Note: No experimental confirmation available.
Show »
Length:713
Mass (Da):79,612
Checksum:i1D110119E43E562C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B0QY63B0QY63_HUMAN
SUN domain-containing protein 2
SUN2
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QY66B0QY66_HUMAN
SUN domain-containing protein 2
SUN2
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QY67B0QY67_HUMAN
SUN domain-containing protein 2
SUN2
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QY69B0QY69_HUMAN
SUN domain-containing protein 2
SUN2
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y686H0Y686_HUMAN
SUN domain-containing protein 2
SUN2
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QY65B0QY65_HUMAN
SUN domain-containing protein 2
SUN2
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QY68B0QY68_HUMAN
SUN domain-containing protein 2
SUN2
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QY64B0QY64_HUMAN
SUN domain-containing protein 2
SUN2
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QY60B0QY60_HUMAN
SUN domain-containing protein 2
SUN2
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA31643 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti644K → R in CAD97926 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05228233T → A. Corresponds to variant dbSNP:rs2072799EnsemblClinVar.1
Natural variantiVAR_05228389L → R1 PublicationCorresponds to variant dbSNP:rs35496634Ensembl.1
Natural variantiVAR_052284348R → C. Corresponds to variant dbSNP:rs138708EnsemblClinVar.1
Natural variantiVAR_024624671G → S1 PublicationCorresponds to variant dbSNP:rs2072797Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045882141V → VEDSEGRGSKVTETEPVSSF PA in isoform 2. 1 Publication1
Alternative sequenceiVSP_053702683 – 717TMATY…GEPAH → SSFPLCPWRLLPILGVCIYV AYHGGLGSWER in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB014568 mRNA Translation: BAA31643.1 Different initiation.
AY682988 mRNA Translation: AAT90500.1
CR456474 mRNA Translation: CAG30360.1
BX537962 mRNA Translation: CAD97926.1
AL008583 Genomic DNA No translation available.
AL021806 Genomic DNA No translation available.
AL021707 Genomic DNA No translation available.
BC030684 mRNA Translation: AAH30684.2
BC094797 mRNA Translation: AAH94797.1
BC111549 mRNA Translation: AAI11550.1
BC111717 mRNA Translation: AAI11718.1
AF202723 mRNA Translation: AAF15887.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13978.1 [Q9UH99-1]
CCDS56231.1 [Q9UH99-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00371

NCBI Reference Sequences

More...
RefSeqi
NP_001186508.1, NM_001199579.1 [Q9UH99-2]
NP_001186509.1, NM_001199580.1 [Q9UH99-1]
NP_056189.1, NM_015374.2 [Q9UH99-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000405018; ENSP00000385616; ENSG00000100242 [Q9UH99-2]
ENST00000405510; ENSP00000385740; ENSG00000100242 [Q9UH99-1]
ENST00000406622; ENSP00000383992; ENSG00000100242 [Q9UH99-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25777

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25777

UCSC genome browser

More...
UCSCi
uc003awh.3 human [Q9UH99-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014568 mRNA Translation: BAA31643.1 Different initiation.
AY682988 mRNA Translation: AAT90500.1
CR456474 mRNA Translation: CAG30360.1
BX537962 mRNA Translation: CAD97926.1
AL008583 Genomic DNA No translation available.
AL021806 Genomic DNA No translation available.
AL021707 Genomic DNA No translation available.
BC030684 mRNA Translation: AAH30684.2
BC094797 mRNA Translation: AAH94797.1
BC111549 mRNA Translation: AAI11550.1
BC111717 mRNA Translation: AAI11718.1
AF202723 mRNA Translation: AAF15887.1
CCDSiCCDS13978.1 [Q9UH99-1]
CCDS56231.1 [Q9UH99-2]
PIRiT00371
RefSeqiNP_001186508.1, NM_001199579.1 [Q9UH99-2]
NP_001186509.1, NM_001199580.1 [Q9UH99-1]
NP_056189.1, NM_015374.2 [Q9UH99-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3UNPX-ray2.39A520-717[»]
4DXRX-ray2.32A522-717[»]
4DXSX-ray2.71A522-717[»]
4DXTX-ray2.22A522-717[»]
4FI9X-ray3.05A523-717[»]
SMRiQ9UH99
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117312, 66 interactors
IntActiQ9UH99, 91 interactors
MINTiQ9UH99
STRINGi9606.ENSP00000385616

PTM databases

GlyConnecti1777
iPTMnetiQ9UH99
PhosphoSitePlusiQ9UH99
SwissPalmiQ9UH99

Polymorphism and mutation databases

BioMutaiSUN2
DMDMi29337242

Proteomic databases

EPDiQ9UH99
jPOSTiQ9UH99
MassIVEiQ9UH99
PaxDbiQ9UH99
PeptideAtlasiQ9UH99
PRIDEiQ9UH99
ProteomicsDBi2587
84289 [Q9UH99-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
25777
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000405018; ENSP00000385616; ENSG00000100242 [Q9UH99-2]
ENST00000405510; ENSP00000385740; ENSG00000100242 [Q9UH99-1]
ENST00000406622; ENSP00000383992; ENSG00000100242 [Q9UH99-1]
GeneIDi25777
KEGGihsa:25777
UCSCiuc003awh.3 human [Q9UH99-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25777
DisGeNETi25777

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SUN2
HGNCiHGNC:14210 SUN2
HPAiHPA001209
MIMi613569 gene
neXtProtiNX_Q9UH99
OpenTargetsiENSG00000100242
PharmGKBiPA165378369

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2687 Eukaryota
ENOG410YM6S LUCA
GeneTreeiENSGT00940000160024
HOGENOMiHOG000253025
InParanoidiQ9UH99
KOiK19347
OMAiGLLYWWV
OrthoDBi1000585at2759
PhylomeDBiQ9UH99
TreeFamiTF323915

Enzyme and pathway databases

ReactomeiR-HSA-1221632 Meiotic synapsis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SUN2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UNC84B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25777

Pharos

More...
Pharosi
Q9UH99

Protein Ontology

More...
PROi
PR:Q9UH99

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000100242 Expressed in 232 organ(s), highest expression level in popliteal artery
ExpressionAtlasiQ9UH99 baseline and differential
GenevisibleiQ9UH99 HS

Family and domain databases

Gene3Di2.60.120.260, 1 hit
InterProiView protein in InterPro
IPR008979 Galactose-bd-like_sf
IPR030272 SUN2
IPR040994 Sun_CC2
IPR012919 SUN_dom
PANTHERiPTHR12911:SF22 PTHR12911:SF22, 1 hit
PfamiView protein in Pfam
PF07738 Sad1_UNC, 1 hit
PF18580 Sun2_CC2, 1 hit
PROSITEiView protein in PROSITE
PS51469 SUN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSUN2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UH99
Secondary accession number(s): B0QY62
, O75156, Q2NKN8, Q2T9F7, Q504T5, Q6B4H1, Q7Z3E3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: March 25, 2003
Last modified: September 18, 2019
This is version 180 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again