Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (22 Apr 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium channel flower homolog

Gene

CACFD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-112308 Presynaptic depolarization and calcium channel opening

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.55.1.1 the synaptic vesicle-associated ca(2+) channel, flower (flower) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium channel flower homolog
Alternative name(s):
Calcium channel flower domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CACFD1
Synonyms:C9orf7
ORF Names:PSEC0107, PSEC0248, UNQ3071/PRO9903
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1365 CACFD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613104 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UGQ2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei33 – 53HelicalSequence analysisAdd BLAST21
Transmembranei58 – 78HelicalSequence analysisAdd BLAST21
Transmembranei103 – 123HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
11094

Open Targets

More...
OpenTargetsi
ENSG00000160325

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25982

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UGQ2 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CACFD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
61212251

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000896711 – 172Calcium channel flower homologAdd BLAST172

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UGQ2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UGQ2

PeptideAtlas

More...
PeptideAtlasi
Q9UGQ2

PRoteomics IDEntifications database

More...
PRIDEi
Q9UGQ2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
24556
84256 [Q9UGQ2-1]
84257 [Q9UGQ2-2]
84258 [Q9UGQ2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UGQ2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UGQ2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160325 Expressed in amniotic fluid and 201 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UGQ2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UGQ2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000160325 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116275, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UGQ2, 9 interactors

Molecular INTeraction database

More...
MINTi
Q9UGQ2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000440832

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UGQ2 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UGQ2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the calcium channel flower family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000529

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1197263_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UGQ2

Identification of Orthologs from Complete Genome Data

More...
OMAi
QHQKQGD

Database of Orthologous Groups

More...
OrthoDBi
1295049at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UGQ2

TreeFam database of animal gene trees

More...
TreeFami
TF105629

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019365 TVP18/Ca-channel_flower

The PANTHER Classification System

More...
PANTHERi
PTHR13314 PTHR13314, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10233 Cg6151-P, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01077 Cg6151-P, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UGQ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSSGGAPGA SASSAPPAQE EGMTWWYRWL CRLSGVLGAV SCAISGLFNC
60 70 80 90 100
ITIHPLNIAA GVWMIMNAFI LLLCEAPFCC QFIEFANTVA EKVDRLRSWQ
110 120 130 140 150
KAVFYCGMAV VPIVISLTLT TLLGNAIAFA TGVLYGLSAL GKKGDAISYA
160 170
RIQQQRQQAD EEKLAETLEG EL
Length:172
Mass (Da):18,470
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i92085A23BDC48439
GO
Isoform 2 (identifier: Q9UGQ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     65-107: IMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCG → M

Show »
Length:130
Mass (Da):13,630
Checksum:i68319E8774E7DD73
GO
Isoform 3 (identifier: Q9UGQ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     65-107: IMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCG → M
     144-172: GDAISYARIQQQRQQADEEKLAETLEGEL → AQTEAGSFAA...SPLLALCGSK

Show »
Length:191
Mass (Da):19,763
Checksum:i030BDAB629DB6DE7
GO
Isoform 4 (identifier: Q9UGQ2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-172: GDAISYARIQQQRQQADEEKLAETLEGEL → AQTEAGSFAA...SPLLALCGSK

Show »
Length:233
Mass (Da):24,604
Checksum:i7B45CDAC57C0EAFC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6TGH8F6TGH8_HUMAN
Calcium channel flower homolog
CACFD1
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti110V → D in BAH12324 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06910358I → M1 PublicationCorresponds to variant dbSNP:rs3124765Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01299765 – 107IMNAF…VFYCG → M in isoform 2 and isoform 3. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_042522144 – 172GDAIS…LEGEL → AQTEAGSFAAQHPREPGPFS EGTRQAFATPAVVSGEIRMP AGAMRSPMPGSSSRGSRRMR RSSRRPWRGSCEGLGAPPSL SPLLALCGSK in isoform 3 and isoform 4. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ011373 mRNA Translation: CAB66156.1
AK075548 mRNA Translation: BAC11691.1
AY358452 mRNA Translation: AAQ88817.1
AK074852 mRNA Translation: BAC11245.1
AK075416 mRNA Translation: BAC11606.1
AK296343 mRNA Translation: BAH12324.1
AK298820 mRNA Translation: BAH12877.1
AL593848 Genomic DNA No translation available.
BC030558 mRNA Translation: AAH30558.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48051.1 [Q9UGQ2-2]
CCDS56591.1 [Q9UGQ2-4]
CCDS56592.1 [Q9UGQ2-3]
CCDS6974.1 [Q9UGQ2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129247.1, NM_001135775.2 [Q9UGQ2-2]
NP_001229298.1, NM_001242369.1 [Q9UGQ2-4]
NP_001229299.1, NM_001242370.1 [Q9UGQ2-3]
NP_060056.1, NM_017586.3 [Q9UGQ2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000291722; ENSP00000291722; ENSG00000160325 [Q9UGQ2-2]
ENST00000316948; ENSP00000317121; ENSG00000160325 [Q9UGQ2-1]
ENST00000540581; ENSP00000440832; ENSG00000160325 [Q9UGQ2-4]
ENST00000542192; ENSP00000444328; ENSG00000160325 [Q9UGQ2-3]
ENST00000625979; ENSP00000486098; ENSG00000280479 [Q9UGQ2-2]
ENST00000627083; ENSP00000486812; ENSG00000280479 [Q9UGQ2-3]
ENST00000629431; ENSP00000486696; ENSG00000280479 [Q9UGQ2-1]
ENST00000630997; ENSP00000485922; ENSG00000280479 [Q9UGQ2-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11094

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11094

UCSC genome browser

More...
UCSCi
uc004cec.3 human [Q9UGQ2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011373 mRNA Translation: CAB66156.1
AK075548 mRNA Translation: BAC11691.1
AY358452 mRNA Translation: AAQ88817.1
AK074852 mRNA Translation: BAC11245.1
AK075416 mRNA Translation: BAC11606.1
AK296343 mRNA Translation: BAH12324.1
AK298820 mRNA Translation: BAH12877.1
AL593848 Genomic DNA No translation available.
BC030558 mRNA Translation: AAH30558.1
CCDSiCCDS48051.1 [Q9UGQ2-2]
CCDS56591.1 [Q9UGQ2-4]
CCDS56592.1 [Q9UGQ2-3]
CCDS6974.1 [Q9UGQ2-1]
RefSeqiNP_001129247.1, NM_001135775.2 [Q9UGQ2-2]
NP_001229298.1, NM_001242369.1 [Q9UGQ2-4]
NP_001229299.1, NM_001242370.1 [Q9UGQ2-3]
NP_060056.1, NM_017586.3 [Q9UGQ2-1]

3D structure databases

SMRiQ9UGQ2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116275, 2 interactors
IntActiQ9UGQ2, 9 interactors
MINTiQ9UGQ2
STRINGi9606.ENSP00000440832

Protein family/group databases

TCDBi1.A.55.1.1 the synaptic vesicle-associated ca(2+) channel, flower (flower) family

PTM databases

iPTMnetiQ9UGQ2
PhosphoSitePlusiQ9UGQ2

Polymorphism and mutation databases

BioMutaiCACFD1
DMDMi61212251

Proteomic databases

jPOSTiQ9UGQ2
MassIVEiQ9UGQ2
PeptideAtlasiQ9UGQ2
PRIDEiQ9UGQ2
ProteomicsDBi24556
84256 [Q9UGQ2-1]
84257 [Q9UGQ2-2]
84258 [Q9UGQ2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3031 89 antibodies

Genome annotation databases

EnsembliENST00000291722; ENSP00000291722; ENSG00000160325 [Q9UGQ2-2]
ENST00000316948; ENSP00000317121; ENSG00000160325 [Q9UGQ2-1]
ENST00000540581; ENSP00000440832; ENSG00000160325 [Q9UGQ2-4]
ENST00000542192; ENSP00000444328; ENSG00000160325 [Q9UGQ2-3]
ENST00000625979; ENSP00000486098; ENSG00000280479 [Q9UGQ2-2]
ENST00000627083; ENSP00000486812; ENSG00000280479 [Q9UGQ2-3]
ENST00000629431; ENSP00000486696; ENSG00000280479 [Q9UGQ2-1]
ENST00000630997; ENSP00000485922; ENSG00000280479 [Q9UGQ2-4]
GeneIDi11094
KEGGihsa:11094
UCSCiuc004cec.3 human [Q9UGQ2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11094
DisGeNETi11094

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CACFD1
HGNCiHGNC:1365 CACFD1
HPAiENSG00000160325 Low tissue specificity
MIMi613104 gene
neXtProtiNX_Q9UGQ2
OpenTargetsiENSG00000160325
PharmGKBiPA25982

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000000529
HOGENOMiCLU_1197263_0_0_1
InParanoidiQ9UGQ2
OMAiQHQKQGD
OrthoDBi1295049at2759
PhylomeDBiQ9UGQ2
TreeFamiTF105629

Enzyme and pathway databases

ReactomeiR-HSA-112308 Presynaptic depolarization and calcium channel opening

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CACFD1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11094
PharosiQ9UGQ2 Tdark

Protein Ontology

More...
PROi
PR:Q9UGQ2
RNActiQ9UGQ2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160325 Expressed in amniotic fluid and 201 other tissues
ExpressionAtlasiQ9UGQ2 baseline and differential
GenevisibleiQ9UGQ2 HS

Family and domain databases

InterProiView protein in InterPro
IPR019365 TVP18/Ca-channel_flower
PANTHERiPTHR13314 PTHR13314, 1 hit
PfamiView protein in Pfam
PF10233 Cg6151-P, 1 hit
SMARTiView protein in SMART
SM01077 Cg6151-P, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFLOWR_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UGQ2
Secondary accession number(s): B7Z3T8
, B7Z5E1, F5GXX4, Q5SXD4, Q8NBM6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: May 1, 2000
Last modified: April 22, 2020
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again