Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal-transducing adaptor protein 2

Gene

STAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.1 Publication

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-8849474 PTK6 Activates STAT3
SignaLinkiQ9UGK3
SIGNORiQ9UGK3

Names & Taxonomyi

Protein namesi
Recommended name:
Signal-transducing adaptor protein 2
Short name:
STAP-2
Alternative name(s):
Breast tumor kinase substrate
Short name:
BRK substrate
Gene namesi
Name:STAP2
Synonyms:BKS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000178078.11
HGNCiHGNC:30430 STAP2
MIMi607881 gene
neXtProtiNX_Q9UGK3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi22Y → F: Small decrease in tyrosine phosphorylation. 1 Publication1
Mutagenesisi250Y → F: Loss of tyrosine phosphorylation. 1 Publication1
Mutagenesisi310Y → F: Decrease in tyrosine phosphorylation. 1 Publication1
Mutagenesisi322Y → F: Decrease in tyrosine phosphorylation. 1 Publication1

Organism-specific databases

DisGeNETi55620
OpenTargetsiENSG00000178078
PharmGKBiPA162404971

Polymorphism and mutation databases

BioMutaiSTAP2
DMDMi229462752

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000722391 – 403Signal-transducing adaptor protein 2Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei22Phosphotyrosine; by SRC1 Publication1
Modified residuei250Phosphotyrosine; by PTK62 Publications1
Modified residuei310Phosphotyrosine1 Publication1
Modified residuei322Phosphotyrosine; by SRC1 Publication1

Post-translational modificationi

Phosphorylated on tyrosine. Tyr-250 may be important for interaction with kinases. Phosphorylated by PTK6 at Tyr-250 modulates PTK6-mediated STAT3 activation. Tyr-22 and Tyr-322 appears to be phosphorylated by SRC.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UGK3
PeptideAtlasiQ9UGK3
PRIDEiQ9UGK3
ProteomicsDBi84227
84228 [Q9UGK3-2]

PTM databases

iPTMnetiQ9UGK3
PhosphoSitePlusiQ9UGK3

Expressioni

Tissue specificityi

Widely expressed.2 Publications

Gene expression databases

BgeeiENSG00000178078 Expressed in 150 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_STAP2
ExpressionAtlasiQ9UGK3 baseline and differential
GenevisibleiQ9UGK3 HS

Organism-specific databases

HPAiHPA002375
HPA027761

Interactioni

Subunit structurei

Interacts with PTK6 and CSF1R.2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi120759, 11 interactors
IntActiQ9UGK3, 7 interactors
MINTiQ9UGK3

Structurei

Secondary structure

1403
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UGK3
SMRiQ9UGK3
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UGK3

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 130PHAdd BLAST113
Domaini133 – 248SH2PROSITE-ProRule annotationAdd BLAST116

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili382 – 402Sequence analysisAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi271 – 359Pro-richAdd BLAST89

Keywords - Domaini

Coiled coil, SH2 domain

Phylogenomic databases

GeneTreeiENSGT00530000063841
HOGENOMiHOG000063725
HOVERGENiHBG108516
InParanoidiQ9UGK3
OMAiPDCGNML
OrthoDBiEOG091G0929
PhylomeDBiQ9UGK3
TreeFamiTF332087

Family and domain databases

CDDicd10404 SH2_STAP2, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR039111 STAP1/STAP2
IPR035878 STAP2_SH2
PANTHERiPTHR16186 PTHR16186, 1 hit
SUPFAMiSSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50001 SH2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UGK3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASALRPPRV PKPKGVLPSH YYESFLEKKG PCDRDYKKFW AGLQGLTIYF
60 70 80 90 100
YNSNRDFQHV EKLNLGAFEK LTDEIPWGSS RDPGTHFSLI LRDQEIKFKV
110 120 130 140 150
ETLECREMWK GFILTVVELR VPTDLTLLPG HLYMMSEVLA KEEARRALET
160 170 180 190 200
PSCFLKVSRL EAQLLLERYP ECGNLLLRPS GDGADGVSVT TRQMHNGTHV
210 220 230 240 250
VRHYKVKREG PKYVIDVEQP FSCTSLDAVV NYFVSHTKKA LVPFLLDEDY
260 270 280 290 300
EKVLGYVEAD KENGENVWVA PSAPGPGPAP CTGGPKPLSP ASSQDKLPPL
310 320 330 340 350
PPLPNQEENY VTPIGDGPAV DYENQDVASS SWPVILKPKK LPKPPAKLPK
360 370 380 390 400
PPVGPKPEPK VFNGGLGRKL PVSSAQPLFP TAGLADMTAE LQKKLEKRRA

LEH
Length:403
Mass (Da):44,894
Last modified:May 5, 2009 - v2
Checksum:iA5E809B3F233EFD0
GO
Isoform 2 (identifier: Q9UGK3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     356-356: K → KPVEKGFHHVAQAGLELLTSSDPPTSASQSAGITGVSHHTWPHLSSL

Note: Alu insert from position 358 to 403.
Show »
Length:449
Mass (Da):49,649
Checksum:i31A9048F7B0E750F
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R0J5M0R0J5_HUMAN
Signal-transducing adaptor protein ...
STAP2
159Annotation score:
M0R2W4M0R2W4_HUMAN
Signal-transducing adaptor protein ...
STAP2
260Annotation score:
M0QY82M0QY82_HUMAN
Signal-transducing adaptor protein ...
STAP2
106Annotation score:
M0QZ60M0QZ60_HUMAN
Signal-transducing adaptor protein ...
STAP2
105Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05523993D → N3 PublicationsCorresponds to variant dbSNP:rs7247504Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041403356K → KPVEKGFHHVAQAGLELLTS SDPPTSASQSAGITGVSHHT WPHLSSL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245719 mRNA Translation: CAB65105.1
AK000241 mRNA Translation: BAA91028.1
AC008616 Genomic DNA No translation available.
BC000795 mRNA Translation: AAH00795.1
CCDSiCCDS12128.1 [Q9UGK3-2]
CCDS45926.1 [Q9UGK3-1]
RefSeqiNP_001013863.1, NM_001013841.1 [Q9UGK3-1]
NP_060190.2, NM_017720.2 [Q9UGK3-2]
UniGeneiHs.194385

Genome annotation databases

EnsembliENST00000594605; ENSP00000471052; ENSG00000178078 [Q9UGK3-1]
ENST00000600324; ENSP00000468927; ENSG00000178078 [Q9UGK3-2]
GeneIDi55620
KEGGihsa:55620
UCSCiuc060rvu.1 human [Q9UGK3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245719 mRNA Translation: CAB65105.1
AK000241 mRNA Translation: BAA91028.1
AC008616 Genomic DNA No translation available.
BC000795 mRNA Translation: AAH00795.1
CCDSiCCDS12128.1 [Q9UGK3-2]
CCDS45926.1 [Q9UGK3-1]
RefSeqiNP_001013863.1, NM_001013841.1 [Q9UGK3-1]
NP_060190.2, NM_017720.2 [Q9UGK3-2]
UniGeneiHs.194385

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EL8NMR-A137-247[»]
ProteinModelPortaliQ9UGK3
SMRiQ9UGK3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120759, 11 interactors
IntActiQ9UGK3, 7 interactors
MINTiQ9UGK3

PTM databases

iPTMnetiQ9UGK3
PhosphoSitePlusiQ9UGK3

Polymorphism and mutation databases

BioMutaiSTAP2
DMDMi229462752

Proteomic databases

EPDiQ9UGK3
PeptideAtlasiQ9UGK3
PRIDEiQ9UGK3
ProteomicsDBi84227
84228 [Q9UGK3-2]

Protocols and materials databases

DNASUi55620
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000594605; ENSP00000471052; ENSG00000178078 [Q9UGK3-1]
ENST00000600324; ENSP00000468927; ENSG00000178078 [Q9UGK3-2]
GeneIDi55620
KEGGihsa:55620
UCSCiuc060rvu.1 human [Q9UGK3-1]

Organism-specific databases

CTDi55620
DisGeNETi55620
EuPathDBiHostDB:ENSG00000178078.11
GeneCardsiSTAP2
H-InvDBiHIX0018702
HGNCiHGNC:30430 STAP2
HPAiHPA002375
HPA027761
MIMi607881 gene
neXtProtiNX_Q9UGK3
OpenTargetsiENSG00000178078
PharmGKBiPA162404971
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063841
HOGENOMiHOG000063725
HOVERGENiHBG108516
InParanoidiQ9UGK3
OMAiPDCGNML
OrthoDBiEOG091G0929
PhylomeDBiQ9UGK3
TreeFamiTF332087

Enzyme and pathway databases

ReactomeiR-HSA-8849474 PTK6 Activates STAT3
SignaLinkiQ9UGK3
SIGNORiQ9UGK3

Miscellaneous databases

ChiTaRSiSTAP2 human
EvolutionaryTraceiQ9UGK3
GeneWikiiSTAP2
GenomeRNAii55620
PROiPR:Q9UGK3
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000178078 Expressed in 150 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_STAP2
ExpressionAtlasiQ9UGK3 baseline and differential
GenevisibleiQ9UGK3 HS

Family and domain databases

CDDicd10404 SH2_STAP2, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR039111 STAP1/STAP2
IPR035878 STAP2_SH2
PANTHERiPTHR16186 PTHR16186, 1 hit
SUPFAMiSSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50001 SH2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSTAP2_HUMAN
AccessioniPrimary (citable) accession number: Q9UGK3
Secondary accession number(s): A6NKK3, Q9NXI2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: May 5, 2009
Last modified: September 12, 2018
This is version 141 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again