Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tight junction protein ZO-2

Gene

TJP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in tight junctions and adherens junctions.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • guanylate kinase activity Source: ProtInc
  • protein binding, bridging Source: UniProtKB
  • protein domain specific binding Source: UniProtKB

GO - Biological processi

  • establishment of endothelial intestinal barrier Source: UniProtKB
  • hippo signaling Source: Reactome
  • intestinal absorption Source: UniProtKB
  • regulation of membrane permeability Source: UniProtKB

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2028269 Signaling by Hippo
R-HSA-351906 Apoptotic cleavage of cell adhesion proteins

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UDY2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tight junction protein ZO-2
Alternative name(s):
Tight junction protein 2
Zona occludens protein 2
Zonula occludens protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TJP2
Synonyms:X104, ZO2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000119139.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11828 TJP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607709 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UDY2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Nucleus, Tight junction

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Familial hypercholanemia (FHCA)1 Publication
The disease may be caused by mutations affecting distinct genetic loci, including the gene represented in this entry.
Disease descriptionA disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
See also OMIM:607748
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01600448V → A in FHCA. 1 PublicationCorresponds to variant dbSNP:rs121918299EnsemblClinVar.1
Cholestasis, progressive familial intrahepatic, 4 (PFIC4)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by early onset of cholestasis that progresses to hepatic fibrosis, cirrhosis, and end-stage liver disease before adulthood.
See also OMIM:615878

Keywords - Diseasei

Disease mutation, Intrahepatic cholestasis

Organism-specific databases

DisGeNET

More...
DisGeNETi
9414

MalaCards human disease database

More...
MalaCardsi
TJP2
MIMi607748 phenotype
615878 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000119139

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
90635 Autosomal dominant non-syndromic sensorineural deafness type DFNA
238475 Familial hypercholanemia
480483 Progressive familial intrahepatic cholestasis type 4

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36533

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TJP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373313

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945431 – 1190Tight junction protein ZO-2Add BLAST1190

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei16PhosphoserineCombined sources1
Modified residuei130PhosphoserineCombined sources1
Modified residuei150PhosphoserineCombined sources1
Modified residuei153PhosphoserineCombined sources1
Modified residuei163PhosphoserineBy similarity1
Modified residuei168PhosphoserineCombined sources1
Modified residuei170PhosphoserineCombined sources1
Modified residuei174PhosphoserineCombined sources1
Modified residuei200PhosphoserineCombined sources1
Modified residuei220PhosphoserineCombined sources1
Modified residuei232PhosphoserineCombined sources1
Modified residuei244PhosphoserineCombined sources1
Modified residuei266PhosphoserineCombined sources1
Modified residuei325PhosphoserineCombined sources1
Modified residuei398PhosphoserineBy similarity1
Modified residuei400PhosphoserineCombined sources1
Modified residuei406PhosphoserineCombined sources1
Modified residuei415PhosphoserineCombined sources1
Modified residuei424PhosphoserineCombined sources1
Modified residuei430PhosphoserineCombined sources1
Modified residuei431PhosphoserineCombined sources1
Modified residuei455PhosphothreonineCombined sources1
Modified residuei499PhosphoserineCombined sources1
Modified residuei574PhosphotyrosineBy similarity1
Modified residuei702PhosphoserineCombined sources1
Modified residuei902PhosphoserineBy similarity1
Modified residuei905PhosphothreonineBy similarity1
Modified residuei913PhosphoserineCombined sources1
Modified residuei920PhosphoserineCombined sources1
Modified residuei925PhosphothreonineCombined sources1
Modified residuei933PhosphothreonineCombined sources1
Modified residuei966PhosphoserineCombined sources1
Modified residuei978PhosphoserineCombined sources1
Modified residuei986PhosphoserineCombined sources1
Modified residuei1006PhosphoserineBy similarity1
Modified residuei1067PhosphoserineCombined sources1
Modified residuei1068PhosphoserineCombined sources1
Modified residuei1118PhosphotyrosineCombined sources1
Modified residuei1131PhosphothreonineCombined sources1
Modified residuei1147PhosphoserineCombined sources1
Modified residuei1159PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UDY2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UDY2

PeptideAtlas

More...
PeptideAtlasi
Q9UDY2

PRoteomics IDEntifications database

More...
PRIDEi
Q9UDY2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84127
84128 [Q9UDY2-2]
84129 [Q9UDY2-3]
84130 [Q9UDY2-4]
84131 [Q9UDY2-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UDY2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UDY2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

This protein is found in epithelial cell junctions. Isoform A1 is abundant in the heart and brain. Detected in brain and skeletal muscle. It is present almost exclusively in normal tissues. Isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. Not detected in brain and skeletal muscle. Found in normal as well as in most neoplastic tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000119139 Expressed in 231 organ(s), highest expression level in spinal cord

CleanEx database of gene expression profiles

More...
CleanExi
HS_TJP2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UDY2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UDY2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009228
HPA001813
HPA070714

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer, and heterodimer with ZO1. Interacts with occludin, SAFB and UBN1. Interaction with SAFB occurs in the nucleus. Interacts with SCRIB. Interacts with USP53 (via the C-terminal region) (By similarity).By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
LASP1Q148479EBI-1042602,EBI-742828

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114809, 76 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9UDY2

Protein interaction database and analysis system

More...
IntActi
Q9UDY2, 38 interactors

Molecular INTeraction database

More...
MINTi
Q9UDY2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000438262

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11190
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UDY2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UDY2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UDY2

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini33 – 120PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini307 – 385PDZ 2PROSITE-ProRule annotationAdd BLAST79
Domaini509 – 590PDZ 3PROSITE-ProRule annotationAdd BLAST82
Domaini604 – 669SH3PROSITE-ProRule annotationAdd BLAST66
Domaini678 – 876Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST199

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1188 – 1190Interaction with SCRIB1 Publication3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1162 – 1165Poly-Glu4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3580 Eukaryota
ENOG410XQP3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158634

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230923

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG017627

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UDY2

KEGG Orthology (KO)

More...
KOi
K06098

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0AJZ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UDY2

TreeFam database of animal gene trees

More...
TreeFami
TF315957

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12027 SH3_ZO-2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR005417 ZO
IPR005419 ZO-2
IPR035598 ZO-2_SH3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF00595 PDZ, 3 hits
PF07653 SH3_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01597 ZONOCCLUDNS
PR01599 ZONOCCLUDNS2

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM00228 PDZ, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform A1 (identifier: Q9UDY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVRGDRGFP PRRELSGWLR APGMEELIWE QYTVTLQKDS KRGFGIAVSG
60 70 80 90 100
GRDNPHFENG ETSIVISDVL PGGPADGLLQ ENDRVVMVNG TPMEDVLHSF
110 120 130 140 150
AVQQLRKSGK VAAIVVKRPR KVQVAALQAS PPLDQDDRAF EVMDEFDGRS
160 170 180 190 200
FRSGYSERSR LNSHGGRSRS WEDSPERGRP HERARSRERD LSRDRSRGRS
210 220 230 240 250
LERGLDQDHA RTRDRSRGRS LERGLDHDFG PSRDRDRDRS RGRSIDQDYE
260 270 280 290 300
RAYHRAYDPD YERAYSPEYR RGARHDARSR GPRSRSREHP HSRSPSPEPR
310 320 330 340 350
GRPGPIGVLL MKSRANEEYG LRLGSQIFVK EMTRTGLATK DGNLHEGDII
360 370 380 390 400
LKINGTVTEN MSLTDARKLI EKSRGKLQLV VLRDSQQTLI NIPSLNDSDS
410 420 430 440 450
EIEDISEIES NRSFSPEERR HQYSDYDYHS SSEKLKERPS SREDTPSRLS
460 470 480 490 500
RMGATPTPFK STGDIAGTVV PETNKEPRYQ EDPPAPQPKA APRTFLRPSP
510 520 530 540 550
EDEAIYGPNT KMVRFKKGDS VGLRLAGGND VGIFVAGIQE GTSAEQEGLQ
560 570 580 590 600
EGDQILKVNT QDFRGLVRED AVLYLLEIPK GEMVTILAQS RADVYRDILA
610 620 630 640 650
CGRGDSFFIR SHFECEKETP QSLAFTRGEV FRVVDTLYDG KLGNWLAVRI
660 670 680 690 700
GNELEKGLIP NKSRAEQMAS VQNAQRDNAG DRADFWRMRG QRSGVKKNLR
710 720 730 740 750
KSREDLTAVV SVSTKFPAYE RVLLREAGFK RPVVLFGPIA DIAMEKLANE
760 770 780 790 800
LPDWFQTAKT EPKDAGSEKS TGVVRLNTVR QIIEQDKHAL LDVTPKAVDL
810 820 830 840 850
LNYTQWFPIV IFFNPDSRQG VKTMRQRLNP TSNKSSRKLF DQANKLKKTC
860 870 880 890 900
AHLFTATINL NSANDSWFGS LKDTIQHQQG EAVWVSEGKM EGMDDDPEDR
910 920 930 940 950
MSYLTAMGAD YLSCDSRLIS DFEDTDGEGG AYTDNELDEP AEEPLVSSIT
960 970 980 990 1000
RSSEPVQHEE SIRKPSPEPR AQMRRAASSD QLRDNSPPPA FKPEPPKAKT
1010 1020 1030 1040 1050
QNKEESYDFS KSYEYKSNPS AVAGNETPGA STKGYPPPVA AKPTFGRSIL
1060 1070 1080 1090 1100
KPSTPIPPQE GEEVGESSEE QDNAPKSVLG KVKIFEKMDH KARLQRMQEL
1110 1120 1130 1140 1150
QEAQNARIEI AQKHPDIYAV PIKTHKPDPG TPQHTSSRPP EPQKAPSRPY
1160 1170 1180 1190
QDTRGSYGSD AEEEEYRQQL SEHSKRGYYG QSARYRDTEL
Note: Produced by alternative promoter usage.
Length:1,190
Mass (Da):133,958
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i27305B723043BF6C
GO
Isoform A2 (identifier: Q9UDY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     961-1107: Missing.

Note: Produced by alternative splicing of isoform A1.
Show »
Length:1,043
Mass (Da):117,758
Checksum:i6EE97CE690160E91
GO
Isoform A3 (identifier: Q9UDY2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     961-993: SIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKP → VRRGRPRAGTGEPGVFLALSWTAVCSGCCGRHS
     994-1190: Missing.

Note: Produced by alternative splicing of isoform A1.
Show »
Length:993
Mass (Da):111,663
Checksum:iD469C9A73851A6D3
GO
Isoform C1 (identifier: Q9UDY2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.

Note: Produced by alternative promoter usage.
Show »
Length:1,167
Mass (Da):131,368
Checksum:i91F7D588687D179E
GO
Isoform C2 (identifier: Q9UDY2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.
     961-1107: Missing.

Note: Produced by alternative splicing of isoform C1.
Show »
Length:1,020
Mass (Da):115,168
Checksum:i4A49BF3F0718D771
GO
Isoform 6 (identifier: Q9UDY2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MPVRGDRGFPPRRELSGWL → MKTAQALHRMWIQAVKKLRRWKG
     961-997: Missing.

Note: No experimental confirmation available.
Show »
Length:1,157
Mass (Da):130,446
Checksum:i30C98BC65E29BC85
GO
Isoform 7 (identifier: Q9UDY2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MPVRGDRGFPPRRELSGWLR → MKTAQALHRMWIQAVKKLRRWKGRVSPSASSPLVFPNLSSWEGEGSKTILT

Note: No experimental confirmation available.
Show »
Length:1,221
Mass (Da):137,342
Checksum:iE185339B2A2F37B4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GTW1A0A1B0GTW1_HUMAN
Tight junction protein ZO-2
TJP2
1,249Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AN86B1AN86_HUMAN
Tight junction protein ZO-2
TJP2
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQJ2U3KQJ2_HUMAN
Tight junction protein ZO-2
TJP2
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA61300 differs from that shown. Reason: Frameshift at positions 1086, 1092 and 1095.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti411N → T in AAA61300 (PubMed:7951235).Curated1
Sequence conflicti411N → T in AAM28524 (Ref. 3) Curated1
Sequence conflicti718A → V in BAH13722 (PubMed:14702039).Curated1
Sequence conflicti782I → V in AAA61300 (PubMed:7951235).Curated1
Sequence conflicti782I → V in AAM28524 (Ref. 3) Curated1
Sequence conflicti808P → S in AAA61300 (PubMed:7951235).Curated1
Sequence conflicti812 – 814FFN → SFT in AAA61300 (PubMed:7951235).Curated3
Sequence conflicti834K → N in AAA61300 (PubMed:7951235).Curated1
Sequence conflicti842Q → H in AAA61300 (PubMed:7951235).Curated1
Sequence conflicti996P → S in AAA61300 (PubMed:7951235).Curated1
Sequence conflicti1093R → G in AAA61300 (PubMed:7951235).Curated1
Sequence conflicti1110I → L in BAH13722 (PubMed:14702039).Curated1
Sequence conflicti1136S → N in AAB41794 (Ref. 9) Curated1
Sequence conflicti1155 – 1158GSYG → RSFC in AAB41794 (Ref. 9) Curated4
Sequence conflicti1165 – 1167EYR → IRS in AAB41794 (Ref. 9) Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01600448V → A in FHCA. 1 PublicationCorresponds to variant dbSNP:rs121918299EnsemblClinVar.1
Natural variantiVAR_030798482D → ECombined sources4 PublicationsCorresponds to variant dbSNP:rs2309428EnsemblClinVar.1
Natural variantiVAR_046675668M → I1 PublicationCorresponds to variant dbSNP:rs34774441EnsemblClinVar.1
Natural variantiVAR_046676711S → P. Corresponds to variant dbSNP:rs35797487EnsemblClinVar.1
Natural variantiVAR_046677822K → N1 PublicationCorresponds to variant dbSNP:rs1049624Ensembl.1
Natural variantiVAR_046678829N → D1 PublicationCorresponds to variant dbSNP:rs1049625Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0069531 – 23Missing in isoform C1 and isoform C2. CuratedAdd BLAST23
Alternative sequenceiVSP_0461141 – 20MPVRG…SGWLR → MKTAQALHRMWIQAVKKLRR WKGRVSPSASSPLVFPNLSS WEGEGSKTILT in isoform 7. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0461151 – 19MPVRG…LSGWL → MKTAQALHRMWIQAVKKLRR WKG in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_003149961 – 1107Missing in isoform A2 and isoform C2. CuratedAdd BLAST147
Alternative sequenceiVSP_046116961 – 997Missing in isoform 6. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_007835961 – 993SIRKP…PAFKP → VRRGRPRAGTGEPGVFLALS WTAVCSGCCGRHS in isoform A3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_007836994 – 1190Missing in isoform A3. 1 PublicationAdd BLAST197

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L27476 mRNA Translation: AAA61300.1 Frameshift.
AF177533
, AF043195, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177530, AF177531, AF177532 Genomic DNA Translation: AAD20387.2
AF177533
, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177530, AF177531, AF177532 Genomic DNA Translation: AAC02527.2
AF177533
, AF043195, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177532 Genomic DNA Translation: AAD56218.2
AF177533
, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177532 Genomic DNA Translation: AAD56219.2
AF489824 mRNA Translation: AAM28524.1
AK295034 mRNA Translation: BAH11954.1
AK302483 mRNA Translation: BAH13722.1
AL162730 Genomic DNA No translation available.
AL358113 Genomic DNA No translation available.
AL590238 Genomic DNA No translation available.
BC027592 mRNA Translation: AAH27592.1
AF083892 mRNA Translation: AAC33121.1
AF083893 mRNA Translation: AAC33122.1
U84581 mRNA Translation: AAB41794.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55315.1 [Q9UDY2-6]
CCDS55316.1 [Q9UDY2-7]
CCDS55317.1 [Q9UDY2-4]
CCDS6627.1 [Q9UDY2-1]
CCDS6628.1 [Q9UDY2-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I54378

NCBI Reference Sequences

More...
RefSeqi
NP_001163886.1, NM_001170415.1 [Q9UDY2-6]
NP_001163887.1, NM_001170416.1 [Q9UDY2-7]
NP_004808.2, NM_004817.3 [Q9UDY2-1]
XP_011517508.1, XM_011519206.2 [Q9UDY2-3]
XP_011517509.1, XM_011519207.2 [Q9UDY2-3]
XP_011517510.1, XM_011519208.2 [Q9UDY2-3]
XP_011517511.1, XM_011519209.2 [Q9UDY2-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.50382
Hs.736223

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000348208; ENSP00000345893; ENSG00000119139 [Q9UDY2-2]
ENST00000377245; ENSP00000366453; ENSG00000119139 [Q9UDY2-1]
ENST00000453658; ENSP00000392178; ENSG00000119139 [Q9UDY2-4]
ENST00000535702; ENSP00000442090; ENSG00000119139 [Q9UDY2-6]
ENST00000539225; ENSP00000438262; ENSG00000119139 [Q9UDY2-7]
ENST00000648204; ENSP00000497941; ENSG00000119139 [Q9UDY2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9414

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9414

UCSC genome browser

More...
UCSCi
uc004ahd.4 human [Q9UDY2-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27476 mRNA Translation: AAA61300.1 Frameshift.
AF177533
, AF043195, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177530, AF177531, AF177532 Genomic DNA Translation: AAD20387.2
AF177533
, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177530, AF177531, AF177532 Genomic DNA Translation: AAC02527.2
AF177533
, AF043195, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177532 Genomic DNA Translation: AAD56218.2
AF177533
, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177532 Genomic DNA Translation: AAD56219.2
AF489824 mRNA Translation: AAM28524.1
AK295034 mRNA Translation: BAH11954.1
AK302483 mRNA Translation: BAH13722.1
AL162730 Genomic DNA No translation available.
AL358113 Genomic DNA No translation available.
AL590238 Genomic DNA No translation available.
BC027592 mRNA Translation: AAH27592.1
AF083892 mRNA Translation: AAC33121.1
AF083893 mRNA Translation: AAC33122.1
U84581 mRNA Translation: AAB41794.1
CCDSiCCDS55315.1 [Q9UDY2-6]
CCDS55316.1 [Q9UDY2-7]
CCDS55317.1 [Q9UDY2-4]
CCDS6627.1 [Q9UDY2-1]
CCDS6628.1 [Q9UDY2-2]
PIRiI54378
RefSeqiNP_001163886.1, NM_001170415.1 [Q9UDY2-6]
NP_001163887.1, NM_001170416.1 [Q9UDY2-7]
NP_004808.2, NM_004817.3 [Q9UDY2-1]
XP_011517508.1, XM_011519206.2 [Q9UDY2-3]
XP_011517509.1, XM_011519207.2 [Q9UDY2-3]
XP_011517510.1, XM_011519208.2 [Q9UDY2-3]
XP_011517511.1, XM_011519209.2 [Q9UDY2-3]
UniGeneiHs.50382
Hs.736223

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OSGNMR-A/B306-385[»]
3E17X-ray1.75A/B306-384[»]
ProteinModelPortaliQ9UDY2
SMRiQ9UDY2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114809, 76 interactors
ELMiQ9UDY2
IntActiQ9UDY2, 38 interactors
MINTiQ9UDY2
STRINGi9606.ENSP00000438262

PTM databases

iPTMnetiQ9UDY2
PhosphoSitePlusiQ9UDY2

Polymorphism and mutation databases

BioMutaiTJP2
DMDMi317373313

Proteomic databases

EPDiQ9UDY2
PaxDbiQ9UDY2
PeptideAtlasiQ9UDY2
PRIDEiQ9UDY2
ProteomicsDBi84127
84128 [Q9UDY2-2]
84129 [Q9UDY2-3]
84130 [Q9UDY2-4]
84131 [Q9UDY2-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9414
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000348208; ENSP00000345893; ENSG00000119139 [Q9UDY2-2]
ENST00000377245; ENSP00000366453; ENSG00000119139 [Q9UDY2-1]
ENST00000453658; ENSP00000392178; ENSG00000119139 [Q9UDY2-4]
ENST00000535702; ENSP00000442090; ENSG00000119139 [Q9UDY2-6]
ENST00000539225; ENSP00000438262; ENSG00000119139 [Q9UDY2-7]
ENST00000648204; ENSP00000497941; ENSG00000119139 [Q9UDY2-1]
GeneIDi9414
KEGGihsa:9414
UCSCiuc004ahd.4 human [Q9UDY2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9414
DisGeNETi9414
EuPathDBiHostDB:ENSG00000119139.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TJP2
HGNCiHGNC:11828 TJP2
HPAiCAB009228
HPA001813
HPA070714
MalaCardsiTJP2
MIMi607709 gene
607748 phenotype
615878 phenotype
neXtProtiNX_Q9UDY2
OpenTargetsiENSG00000119139
Orphaneti90635 Autosomal dominant non-syndromic sensorineural deafness type DFNA
238475 Familial hypercholanemia
480483 Progressive familial intrahepatic cholestasis type 4
PharmGKBiPA36533

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3580 Eukaryota
ENOG410XQP3 LUCA
GeneTreeiENSGT00940000158634
HOGENOMiHOG000230923
HOVERGENiHBG017627
InParanoidiQ9UDY2
KOiK06098
OrthoDBiEOG091G0AJZ
PhylomeDBiQ9UDY2
TreeFamiTF315957

Enzyme and pathway databases

ReactomeiR-HSA-2028269 Signaling by Hippo
R-HSA-351906 Apoptotic cleavage of cell adhesion proteins
SIGNORiQ9UDY2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TJP2 human
EvolutionaryTraceiQ9UDY2

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Tight_junction_protein_2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9414

Protein Ontology

More...
PROi
PR:Q9UDY2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000119139 Expressed in 231 organ(s), highest expression level in spinal cord
CleanExiHS_TJP2
ExpressionAtlasiQ9UDY2 baseline and differential
GenevisibleiQ9UDY2 HS

Family and domain databases

CDDicd12027 SH3_ZO-2, 1 hit
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR005417 ZO
IPR005419 ZO-2
IPR035598 ZO-2_SH3
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF00595 PDZ, 3 hits
PF07653 SH3_2, 1 hit
PRINTSiPR01597 ZONOCCLUDNS
PR01599 ZONOCCLUDNS2
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00228 PDZ, 3 hits
SUPFAMiSSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZO2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UDY2
Secondary accession number(s): A2A3H9
, B7Z2R8, B7Z7T6, F5H301, F5H886, Q15883, Q5VXL0, Q5VXL1, Q8N756, Q8NI14, Q99839, Q9UDY0, Q9UDY1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: December 5, 2018
This is version 201 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again