Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein Wnt-16

Gene

WNT16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity).By similarity

GO - Molecular functioni

  • frizzled binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processWnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-3238698 WNT ligand biogenesis and trafficking
R-HSA-373080 Class B/2 (Secretin family receptors)
SignaLinkiQ9UBV4
SIGNORiQ9UBV4

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Wnt-16
Gene namesi
Name:WNT16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000002745.12
HGNCiHGNC:16267 WNT16
MIMi606267 gene
neXtProtiNX_Q9UBV4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi51384
OpenTargetsiENSG00000002745
PharmGKBiPA38105

Polymorphism and mutation databases

BioMutaiWNT16
DMDMi12643875

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000004147130 – 365Protein Wnt-16Add BLAST336

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi81 ↔ 92By similarity
Disulfide bondi139 ↔ 147By similarity
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi149 ↔ 168By similarity
Glycosylationi189N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi221 ↔ 235By similarity
Disulfide bondi223 ↔ 230By similarity
Lipidationi227O-palmitoleoyl serine; by PORCNBy similarity1
Disulfide bondi310 ↔ 325By similarity
Glycosylationi311N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi340 ↔ 355By similarity
Disulfide bondi342 ↔ 352By similarity
Disulfide bondi347 ↔ 348By similarity

Post-translational modificationi

Palmitoleoylation is required for efficient binding to frizzled receptors. Depalmitoleoylation leads to Wnt signaling pathway inhibition.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein

Proteomic databases

PaxDbiQ9UBV4
PeptideAtlasiQ9UBV4
PRIDEiQ9UBV4
ProteomicsDBi84079
84080 [Q9UBV4-2]

PTM databases

iPTMnetiQ9UBV4
PhosphoSitePlusiQ9UBV4

Expressioni

Tissue specificityi

Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas.

Gene expression databases

BgeeiENSG00000002745 Expressed in 81 organ(s), highest expression level in ectocervix
CleanExiHS_WNT16
ExpressionAtlasiQ9UBV4 baseline and differential
GenevisibleiQ9UBV4 HS

Organism-specific databases

HPAiHPA027030

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119514, 12 interactors
IntActiQ9UBV4, 1 interactor
STRINGi9606.ENSP00000222462

Structurei

3D structure databases

ProteinModelPortaliQ9UBV4
SMRiQ9UBV4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the Wnt family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3913 Eukaryota
ENOG410XQZ1 LUCA
GeneTreeiENSGT00760000118943
HOGENOMiHOG000039529
HOVERGENiHBG001595
InParanoidiQ9UBV4
KOiK01558
OMAiYINKSPN
OrthoDBiEOG091G0OFF
PhylomeDBiQ9UBV4
TreeFamiTF105310

Family and domain databases

InterProiView protein in InterPro
IPR005817 Wnt
IPR013304 Wnt16
IPR018161 Wnt_CS
PANTHERiPTHR12027 PTHR12027, 1 hit
PfamiView protein in Pfam
PF00110 wnt, 1 hit
PRINTSiPR01895 WNT16PROTEIN
PR01349 WNTPROTEIN
SMARTiView protein in SMART
SM00097 WNT1, 1 hit
PROSITEiView protein in PROSITE
PS00246 WNT1, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform Wnt-16b (identifier: Q9UBV4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRAALLGLA RLCALWAALL VLFPYGAQGN WMWLGIASFG VPEKLGCANL
60 70 80 90 100
PLNSRQKELC KRKPYLLPSI REGARLGIQE CGSQFRHERW NCMITAAATT
110 120 130 140 150
APMGASPLFG YELSSGTKET AFIYAVMAAG LVHSVTRSCS AGNMTECSCD
160 170 180 190 200
TTLQNGGSAS EGWHWGGCSD DVQYGMWFSR KFLDFPIGNT TGKENKVLLA
210 220 230 240 250
MNLHNNEAGR QAVAKLMSVD CRCHGVSGSC AVKTCWKTMS SFEKIGHLLK
260 270 280 290 300
DKYENSIQIS DKTKRKMRRR EKDQRKIPIH KDDLLYVNKS PNYCVEDKKL
310 320 330 340 350
GIPGTQGREC NRTSEGADGC NLLCCGRGYN THVVRHVERC ECKFIWCCYV
360
RCRRCESMTD VHTCK
Length:365
Mass (Da):40,690
Last modified:May 1, 2000 - v1
Checksum:i313A26D8FFBCC56F
GO
Isoform Wnt-16a (identifier: Q9UBV4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MDRAALLGLARLCALWAALLVLFPYGAQGNWM → MERHPPMQLTTCLRETLFTGASQKTSLW

Show »
Length:361
Mass (Da):40,447
Checksum:i9C823B8C92850BBF
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PH60E9PH60_HUMAN
Protein Wnt
WNT16
355Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05295782G → R1 PublicationCorresponds to variant dbSNP:rs2908004Ensembl.1
Natural variantiVAR_036289126V → M in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_052958263T → I1 PublicationCorresponds to variant dbSNP:rs2707466Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0067971 – 32MDRAA…QGNWM → MERHPPMQLTTCLRETLFTG ASQKTSLW in isoform Wnt-16a. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF169963 mRNA Translation: AAD49351.1
AF152584 mRNA Translation: AAD38052.1
AC006364 Genomic DNA No translation available.
BC104919 mRNA Translation: AAI04920.1
BC104945 mRNA Translation: AAI04946.1
CCDSiCCDS5781.1 [Q9UBV4-1]
RefSeqiNP_057171.2, NM_016087.2
NP_476509.1, NM_057168.1 [Q9UBV4-1]
UniGeneiHs.272375

Genome annotation databases

EnsembliENST00000222462; ENSP00000222462; ENSG00000002745 [Q9UBV4-1]
GeneIDi51384
KEGGihsa:51384
UCSCiuc003vjw.4 human [Q9UBV4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF169963 mRNA Translation: AAD49351.1
AF152584 mRNA Translation: AAD38052.1
AC006364 Genomic DNA No translation available.
BC104919 mRNA Translation: AAI04920.1
BC104945 mRNA Translation: AAI04946.1
CCDSiCCDS5781.1 [Q9UBV4-1]
RefSeqiNP_057171.2, NM_016087.2
NP_476509.1, NM_057168.1 [Q9UBV4-1]
UniGeneiHs.272375

3D structure databases

ProteinModelPortaliQ9UBV4
SMRiQ9UBV4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119514, 12 interactors
IntActiQ9UBV4, 1 interactor
STRINGi9606.ENSP00000222462

PTM databases

iPTMnetiQ9UBV4
PhosphoSitePlusiQ9UBV4

Polymorphism and mutation databases

BioMutaiWNT16
DMDMi12643875

Proteomic databases

PaxDbiQ9UBV4
PeptideAtlasiQ9UBV4
PRIDEiQ9UBV4
ProteomicsDBi84079
84080 [Q9UBV4-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222462; ENSP00000222462; ENSG00000002745 [Q9UBV4-1]
GeneIDi51384
KEGGihsa:51384
UCSCiuc003vjw.4 human [Q9UBV4-1]

Organism-specific databases

CTDi51384
DisGeNETi51384
EuPathDBiHostDB:ENSG00000002745.12
GeneCardsiWNT16
HGNCiHGNC:16267 WNT16
HPAiHPA027030
MIMi606267 gene
neXtProtiNX_Q9UBV4
OpenTargetsiENSG00000002745
PharmGKBiPA38105
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3913 Eukaryota
ENOG410XQZ1 LUCA
GeneTreeiENSGT00760000118943
HOGENOMiHOG000039529
HOVERGENiHBG001595
InParanoidiQ9UBV4
KOiK01558
OMAiYINKSPN
OrthoDBiEOG091G0OFF
PhylomeDBiQ9UBV4
TreeFamiTF105310

Enzyme and pathway databases

ReactomeiR-HSA-3238698 WNT ligand biogenesis and trafficking
R-HSA-373080 Class B/2 (Secretin family receptors)
SignaLinkiQ9UBV4
SIGNORiQ9UBV4

Miscellaneous databases

GeneWikiiWNT16
GenomeRNAii51384
PROiPR:Q9UBV4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000002745 Expressed in 81 organ(s), highest expression level in ectocervix
CleanExiHS_WNT16
ExpressionAtlasiQ9UBV4 baseline and differential
GenevisibleiQ9UBV4 HS

Family and domain databases

InterProiView protein in InterPro
IPR005817 Wnt
IPR013304 Wnt16
IPR018161 Wnt_CS
PANTHERiPTHR12027 PTHR12027, 1 hit
PfamiView protein in Pfam
PF00110 wnt, 1 hit
PRINTSiPR01895 WNT16PROTEIN
PR01349 WNTPROTEIN
SMARTiView protein in SMART
SM00097 WNT1, 1 hit
PROSITEiView protein in PROSITE
PS00246 WNT1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiWNT16_HUMAN
AccessioniPrimary (citable) accession number: Q9UBV4
Secondary accession number(s): Q2M3G1, Q9Y5C0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 144 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again