Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (13 Feb 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Appetite-regulating hormone

Gene

GHRL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.
Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHormone

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9UBU3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Appetite-regulating hormone
Alternative name(s):
Growth hormone secretagogue
Growth hormone-releasing peptide
Motilin-related peptide
Protein M46
Cleaved into the following 3 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GHRL
Synonyms:MTLRP
ORF Names:UNQ524/PRO1066
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000157017.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18129 GHRL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605353 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UBU3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51738

MalaCards human disease database

More...
MalaCardsi
GHRL

Open Targets

More...
OpenTargetsi
ENSG00000157017

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671740

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1921664

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GHRL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
17865471

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 232 PublicationsAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_000001920224 – 51Ghrelin-28Add BLAST28
PeptideiPRO_000001920324 – 50Ghrelin-27Add BLAST27
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000001920452 – 75Removed in mature formAdd BLAST24
PeptideiPRO_000004514076 – 98ObestatinBy similarityAdd BLAST23
PropeptideiPRO_000004514199 – 117Removed in mature formBy similarityAdd BLAST19

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi26O-decanoyl serine; alternate2 Publications1
Lipidationi26O-octanoyl serine; alternate2 Publications1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei98Leucine amideBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-octanoylation or O-decanoylation is essential for ghrelin activity. The O-decanoylated forms Ghrelin-27-C10 and Ghrelin-28-C10 differ in the length of the carbon backbone of the carboxylic acid bound to Ser-26. A small fraction of ghrelin, ghrelin-28-C10:1, may be modified with a singly unsaturated carboxylic acid (PubMed:10604470).1 Publication
Amidation of Leu-98 is essential for obestatin activity.By similarity

Keywords - PTMi

Amidation, Lipoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UBU3

PeptideAtlas

More...
PeptideAtlasi
Q9UBU3

PRoteomics IDEntifications database

More...
PRIDEi
Q9UBU3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84065
84066 [Q9UBU3-2]
84067 [Q9UBU3-3]
84068 [Q9UBU3-4]
84069 [Q9UBU3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UBU3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UBU3

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q9UBU3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157017 Expressed in 120 organ(s), highest expression level in fundus of stomach

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UBU3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UBU3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB022731
HPA014246

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119706, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UBU3, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000335074

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9UBU3

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P7Xmodel-A1-117[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UBU3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the motilin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IZYV Eukaryota
ENOG410ZG1B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004064

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000146466

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG018522

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UBU3

KEGG Orthology (KO)

More...
KOi
K05254

Identification of Orthologs from Complete Genome Data

More...
OMAi
EIQFNAP

Database of Orthologous Groups

More...
OrthoDBi
1600403at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UBU3

TreeFam database of animal gene trees

More...
TreeFami
TF336219

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006737 Motilin_assoc
IPR006738 Motilin_ghrelin
IPR005441 Preproghrelin

The PANTHER Classification System

More...
PANTHERi
PTHR14122 PTHR14122, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04643 Motilin_assoc, 1 hit
PF04644 Motilin_ghrelin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01624 GHRELIN

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBU3-1) [UniParc]FASTAAdd to basket
Also known as: Ghrelin

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSPGTVCSL LLLGMLWLDL AMAGSSFLSP EHQRVQQRKE SKKPPAKLQP
60 70 80 90 100
RALAGWLRPE DGGQAEGAED ELEVRFNAPF DVGIKLSGVQ YQQHSQALGK
110
FLQDILWEEA KEAPADK
Length:117
Mass (Da):12,911
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i39C0572EBECA2755
GO
Isoform 2 (identifier: Q9UBU3-2) [UniParc]FASTAAdd to basket
Also known as: des-Gln14-ghrelin

The sequence of this isoform differs from the canonical sequence as follows:
     37-37: Missing.

Show »
Length:116
Mass (Da):12,783
Checksum:iF0DEBEEE880DC951
GO
Isoform 3 (identifier: Q9UBU3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQ → MFTCWWSYLRSTLAAVPGEASRVQ

Show »
Length:105
Mass (Da):11,784
Checksum:i9E4000D6A0863F99
GO
Isoform 4 (identifier: Q9UBU3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQ → MFTCWWSYLRSTLAAVPGEASRVQ
     37-37: Missing.

Show »
Length:104
Mass (Da):11,656
Checksum:i508946F0C415058F
GO
Isoform 5 (identifier: Q9UBU3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: MPSPGTVCSL...EGAEDELEVR → MFTCWWSYLRSTLAAVPGEASRVQ

Show »
Length:66
Mass (Da):7,460
Checksum:i5001F0A57716C83D
GO
Isoform 6 (identifier: Q9UBU3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-117: FNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK → RPQPTSDRPQALLTSL

Show »
Length:91
Mass (Da):9,972
Checksum:iE7E532D32A3F8609
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ESW0E7ESW0_HUMAN
Appetite-regulating hormone
GHRL
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8DN24A8DN24_HUMAN
Appetite-regulating hormone
GHRL
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi

Molecular mass is 3398.9±0.3 Da from positions 24 - 51. Determined by ESI. Ghrelin-28-C10, O-decanoylated form.1 Publication
Molecular mass is 3397.2±0.5 Da from positions 24 - 51. Determined by ESI. Ghrelin-28-C10:1, O-decenoylated form.1 Publication
Molecular mass is 3371.3±0.1 Da from positions 24 - 51. Determined by ESI. Ghrelin-28-C8, O-octanoylated form.1 Publication
Molecular mass is 3243.6±0.4 Da from positions 24 - 50. Determined by ESI. Ghrelin-27-C10, O-decanoylated form.1 Publication
Molecular mass is 3214.6±0.6 Da from positions 24 - 50. Determined by ESI. Ghrelin-27-C8, O-octanoylated form.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05009572L → M1 PublicationCorresponds to variant dbSNP:rs696217Ensembl.1
Natural variantiVAR_02913590Q → L. Corresponds to variant dbSNP:rs4684677Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0414381 – 75MPSPG…ELEVR → MFTCWWSYLRSTLAAVPGEA SRVQ in isoform 5. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0414371 – 36MPSPG…HQRVQ → MFTCWWSYLRSTLAAVPGEA SRVQ in isoform 3 and isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_00324537Missing in isoform 2 and isoform 4. 2 Publications1
Alternative sequenceiVSP_04764276 – 117FNAPF…APADK → RPQPTSDRPQALLTSL in isoform 6. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB029434 mRNA Translation: BAA89371.1
AJ252278 mRNA Translation: CAB65733.1
AF296558 Genomic DNA Translation: AAG10300.1
EU072086 mRNA Translation: ABV55189.1
EF549569 mRNA Translation: ABQ40357.1
EF549571 mRNA Translation: ABQ40358.1
EF549572 mRNA Translation: ABQ40359.1
EF549573 mRNA Translation: ABQ40360.1
EF549574 mRNA Translation: ABQ40361.1
EF549575 mRNA Translation: ABQ40362.1
EU072083 mRNA Translation: ABV55186.1
EU072084 mRNA Translation: ABV55187.1
EU072085 mRNA Translation: ABV55188.1
EU072087 mRNA Translation: ABV55190.1
AY184207 mRNA Translation: AAO27351.1
AY359053 mRNA Translation: AAQ89412.1
AC022384 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64074.1
CH471055 Genomic DNA Translation: EAW64075.1
BC025791 mRNA Translation: AAH25791.1
AB035700 mRNA Translation: BAB19045.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33700.1 [Q9UBU3-1]
CCDS46747.1 [Q9UBU3-5]
CCDS46748.1 [Q9UBU3-3]
CCDS46749.1 [Q9UBU3-4]
CCDS46750.1 [Q9UBU3-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A59316

NCBI Reference Sequences

More...
RefSeqi
NP_001128413.1, NM_001134941.2 [Q9UBU3-2]
NP_001128416.1, NM_001134944.1 [Q9UBU3-3]
NP_001128417.1, NM_001134945.1 [Q9UBU3-4]
NP_001128418.1, NM_001134946.1 [Q9UBU3-5]
NP_001289750.1, NM_001302821.1 [Q9UBU3-1]
NP_001289751.1, NM_001302822.1 [Q9UBU3-1]
NP_001289752.1, NM_001302823.1 [Q9UBU3-2]
NP_001289753.1, NM_001302824.1 [Q9UBU3-1]
NP_001289754.1, NM_001302825.1 [Q9UBU3-1]
NP_057446.1, NM_016362.4 [Q9UBU3-1]
XP_016862101.1, XM_017006612.1 [Q9UBU3-1]
XP_016862102.1, XM_017006613.1 [Q9UBU3-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.590080
Hs.672979

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000287656; ENSP00000287656; ENSG00000157017 [Q9UBU3-2]
ENST00000335542; ENSP00000335074; ENSG00000157017 [Q9UBU3-1]
ENST00000422159; ENSP00000405464; ENSG00000157017 [Q9UBU3-6]
ENST00000429122; ENSP00000414819; ENSG00000157017 [Q9UBU3-1]
ENST00000430179; ENSP00000399922; ENSG00000157017 [Q9UBU3-2]
ENST00000437422; ENSP00000416768; ENSG00000157017 [Q9UBU3-3]
ENST00000439975; ENSP00000403725; ENSG00000157017 [Q9UBU3-5]
ENST00000449238; ENSP00000388145; ENSG00000157017 [Q9UBU3-4]
ENST00000457360; ENSP00000391406; ENSG00000157017 [Q9UBU3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51738

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51738

UCSC genome browser

More...
UCSCi
uc003bvj.2 human [Q9UBU3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
Protein Spotlight

Gut feelings - Issue 66 of January 2006

Wikipedia

Ghrelin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB029434 mRNA Translation: BAA89371.1
AJ252278 mRNA Translation: CAB65733.1
AF296558 Genomic DNA Translation: AAG10300.1
EU072086 mRNA Translation: ABV55189.1
EF549569 mRNA Translation: ABQ40357.1
EF549571 mRNA Translation: ABQ40358.1
EF549572 mRNA Translation: ABQ40359.1
EF549573 mRNA Translation: ABQ40360.1
EF549574 mRNA Translation: ABQ40361.1
EF549575 mRNA Translation: ABQ40362.1
EU072083 mRNA Translation: ABV55186.1
EU072084 mRNA Translation: ABV55187.1
EU072085 mRNA Translation: ABV55188.1
EU072087 mRNA Translation: ABV55190.1
AY184207 mRNA Translation: AAO27351.1
AY359053 mRNA Translation: AAQ89412.1
AC022384 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64074.1
CH471055 Genomic DNA Translation: EAW64075.1
BC025791 mRNA Translation: AAH25791.1
AB035700 mRNA Translation: BAB19045.1
CCDSiCCDS33700.1 [Q9UBU3-1]
CCDS46747.1 [Q9UBU3-5]
CCDS46748.1 [Q9UBU3-3]
CCDS46749.1 [Q9UBU3-4]
CCDS46750.1 [Q9UBU3-2]
PIRiA59316
RefSeqiNP_001128413.1, NM_001134941.2 [Q9UBU3-2]
NP_001128416.1, NM_001134944.1 [Q9UBU3-3]
NP_001128417.1, NM_001134945.1 [Q9UBU3-4]
NP_001128418.1, NM_001134946.1 [Q9UBU3-5]
NP_001289750.1, NM_001302821.1 [Q9UBU3-1]
NP_001289751.1, NM_001302822.1 [Q9UBU3-1]
NP_001289752.1, NM_001302823.1 [Q9UBU3-2]
NP_001289753.1, NM_001302824.1 [Q9UBU3-1]
NP_001289754.1, NM_001302825.1 [Q9UBU3-1]
NP_057446.1, NM_016362.4 [Q9UBU3-1]
XP_016862101.1, XM_017006612.1 [Q9UBU3-1]
XP_016862102.1, XM_017006613.1 [Q9UBU3-2]
UniGeneiHs.590080
Hs.672979

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P7Xmodel-A1-117[»]
ProteinModelPortaliQ9UBU3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119706, 5 interactors
IntActiQ9UBU3, 2 interactors
STRINGi9606.ENSP00000335074

Chemistry databases

BindingDBiQ9UBU3
ChEMBLiCHEMBL1921664

PTM databases

iPTMnetiQ9UBU3
PhosphoSitePlusiQ9UBU3

Polymorphism and mutation databases

BioMutaiGHRL
DMDMi17865471

Proteomic databases

PaxDbiQ9UBU3
PeptideAtlasiQ9UBU3
PRIDEiQ9UBU3
ProteomicsDBi84065
84066 [Q9UBU3-2]
84067 [Q9UBU3-3]
84068 [Q9UBU3-4]
84069 [Q9UBU3-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51738
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000287656; ENSP00000287656; ENSG00000157017 [Q9UBU3-2]
ENST00000335542; ENSP00000335074; ENSG00000157017 [Q9UBU3-1]
ENST00000422159; ENSP00000405464; ENSG00000157017 [Q9UBU3-6]
ENST00000429122; ENSP00000414819; ENSG00000157017 [Q9UBU3-1]
ENST00000430179; ENSP00000399922; ENSG00000157017 [Q9UBU3-2]
ENST00000437422; ENSP00000416768; ENSG00000157017 [Q9UBU3-3]
ENST00000439975; ENSP00000403725; ENSG00000157017 [Q9UBU3-5]
ENST00000449238; ENSP00000388145; ENSG00000157017 [Q9UBU3-4]
ENST00000457360; ENSP00000391406; ENSG00000157017 [Q9UBU3-1]
GeneIDi51738
KEGGihsa:51738
UCSCiuc003bvj.2 human [Q9UBU3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51738
DisGeNETi51738
EuPathDBiHostDB:ENSG00000157017.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GHRL
HGNCiHGNC:18129 GHRL
HPAiCAB022731
HPA014246
MalaCardsiGHRL
MIMi605353 gene
neXtProtiNX_Q9UBU3
OpenTargetsiENSG00000157017
PharmGKBiPA142671740

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IZYV Eukaryota
ENOG410ZG1B LUCA
GeneTreeiENSGT00390000004064
HOGENOMiHOG000146466
HOVERGENiHBG018522
InParanoidiQ9UBU3
KOiK05254
OMAiEIQFNAP
OrthoDBi1600403at2759
PhylomeDBiQ9UBU3
TreeFamiTF336219

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin
SIGNORiQ9UBU3

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Ghrelin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51738
PMAP-CutDBiQ9UBU3

Protein Ontology

More...
PROi
PR:Q9UBU3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157017 Expressed in 120 organ(s), highest expression level in fundus of stomach
ExpressionAtlasiQ9UBU3 baseline and differential
GenevisibleiQ9UBU3 HS

Family and domain databases

InterProiView protein in InterPro
IPR006737 Motilin_assoc
IPR006738 Motilin_ghrelin
IPR005441 Preproghrelin
PANTHERiPTHR14122 PTHR14122, 1 hit
PfamiView protein in Pfam
PF04643 Motilin_assoc, 1 hit
PF04644 Motilin_ghrelin, 1 hit
PRINTSiPR01624 GHRELIN

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGHRL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBU3
Secondary accession number(s): A8CF34
, A8CF38, A8CF42, A8DN29, A8DN30, Q86YP8, Q8TAT9, Q9H3R3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 13, 2001
Last sequence update: May 1, 2000
Last modified: February 13, 2019
This is version 180 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again