Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA polymerase kappa

Gene

POLK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity.8 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication, Mn2+1 PublicationNote: Divalent metal cations. Prefers Mg2+, but can also use Mn2+.1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>pH dependencei

Optimum pH is 6.5-7.5.1 Publication

Temperature dependencei

Optimum temperature is 37 degrees Celsius.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi107MagnesiumBy similarity1
Metal bindingi198MagnesiumBy similarity1
Metal bindingi199MagnesiumBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri621 – 647UBZ-type 1Add BLAST27
Zinc fingeri776 – 802UBZ-type 2Add BLAST27

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, DNA-directed DNA polymerase, Mutator protein, Nucleotidyltransferase, Transferase
Biological processDNA damage, DNA repair, DNA replication, DNA synthesis
LigandMagnesium, Metal-binding, Schiff base, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5655862 Translesion synthesis by POLK
R-HSA-5656169 Termination of translesion DNA synthesis
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5696397 Gap-filling DNA repair synthesis and ligation in GG-NER
R-HSA-5696400 Dual Incision in GG-NER
R-HSA-6782135 Dual incision in TC-NER
R-HSA-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA polymerase kappa (EC:2.7.7.71 Publication)
Alternative name(s):
DINB protein
Short name:
DINP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:POLK
Synonyms:DINB1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000122008.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9183 POLK

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605650 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UBT6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi198D → A: Loss of DNA polymerase activity; when associated with A-199. 1 Publication1
Mutagenesisi199E → A: Loss of DNA polymerase activity; when associated with D-198. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
51426

MalaCards human disease database

More...
MalaCardsi
POLK

Open Targets

More...
OpenTargetsi
ENSG00000122008

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33503

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5365

Drug and drug target database

More...
DrugBanki
DB08237 2'-deoxy-N-(naphthalen-1-ylmethyl)guanosine 5'-(dihydrogen phosphate)

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
POLK

Domain mapping of disease mutations (DMDM)

More...
DMDMi
59798438

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001739901 – 870DNA polymerase kappaAdd BLAST870

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UBT6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UBT6

PeptideAtlas

More...
PeptideAtlasi
Q9UBT6

PRoteomics IDEntifications database

More...
PRIDEi
Q9UBT6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
84057
84058 [Q9UBT6-2]
84059 [Q9UBT6-3]
84060 [Q9UBT6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UBT6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UBT6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected at low levels in testis, spleen, prostate and ovary. Detected at very low levels in kidney, colon, brain, heart, liver, lung, placenta, pancreas and peripheral blood leukocytes.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000122008 Expressed in 202 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UBT6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UBT6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA012035
HPA057303
HPA068117
HPA069375

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with REV1 (By similarity). Interacts with PCNA (PubMed:11784855).By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119532, 44 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9UBT6

Protein interaction database and analysis system

More...
IntActi
Q9UBT6, 26 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000241436

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9UBT6

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9UBT6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UBT6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UBT6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini103 – 358UmuCAdd BLAST256

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DNA polymerase type-Y family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri621 – 647UBZ-type 1Add BLAST27
Zinc fingeri776 – 802UBZ-type 2Add BLAST27

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2094 Eukaryota
COG0389 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156667

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000082711

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG101212

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UBT6

KEGG Orthology (KO)

More...
KOi
K03511

Identification of Orthologs from Complete Genome Data

More...
OMAi
HVDACLD

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0679

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UBT6

TreeFam database of animal gene trees

More...
TreeFami
TF314387

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03586 PolY_Pol_IV_kappa, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1490.100, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_01113 DNApol_IV, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036775 DNA_pol_Y-fam_lit_finger_sf
IPR017961 DNA_pol_Y-fam_little_finger
IPR022880 DNApol_IV
IPR024728 PolY_HhH_motif
IPR001126 UmuC
IPR006642 Znf_Rad18_put

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00817 IMS, 1 hit
PF11799 IMS_C, 1 hit
PF11798 IMS_HHH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00734 ZnF_Rad18, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100879 SSF100879, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50173 UMUC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSTKEKCDS YKDDLLLRMG LNDNKAGMEG LDKEKINKII MEATKGSRFY
60 70 80 90 100
GNELKKEKQV NQRIENMMQQ KAQITSQQLR KAQLQVDRFA MELEQSRNLS
110 120 130 140 150
NTIVHIDMDA FYAAVEMRDN PELKDKPIAV GSMSMLSTSN YHARRFGVRA
160 170 180 190 200
AMPGFIAKRL CPQLIIVPPN FDKYRAVSKE VKEILADYDP NFMAMSLDEA
210 220 230 240 250
YLNITKHLEE RQNWPEDKRR YFIKMGSSVE NDNPGKEVNK LSEHERSISP
260 270 280 290 300
LLFEESPSDV QPPGDPFQVN FEEQNNPQIL QNSVVFGTSA QEVVKEIRFR
310 320 330 340 350
IEQKTTLTAS AGIAPNTMLA KVCSDKNKPN GQYQILPNRQ AVMDFIKDLP
360 370 380 390 400
IRKVSGIGKV TEKMLKALGI ITCTELYQQR ALLSLLFSET SWHYFLHISL
410 420 430 440 450
GLGSTHLTRD GERKSMSVER TFSEINKAEE QYSLCQELCS ELAQDLQKER
460 470 480 490 500
LKGRTVTIKL KNVNFEVKTR ASTVSSVVST AEEIFAIAKE LLKTEIDADF
510 520 530 540 550
PHPLRLRLMG VRISSFPNEE DRKHQQRSII GFLQAGNQAL SATECTLEKT
560 570 580 590 600
DKDKFVKPLE MSHKKSFFDK KRSERKWSHQ DTFKCEAVNK QSFQTSQPFQ
610 620 630 640 650
VLKKKMNENL EISENSDDCQ ILTCPVCFRA QGCISLEALN KHVDECLDGP
660 670 680 690 700
SISENFKMFS CSHVSATKVN KKENVPASSL CEKQDYEAHP KIKEISSVDC
710 720 730 740 750
IALVDTIDNS SKAESIDALS NKHSKEECSS LPSKSFNIEH CHQNSSSTVS
760 770 780 790 800
LENEDVGSFR QEYRQPYLCE VKTGQALVCP VCNVEQKTSD LTLFNVHVDV
810 820 830 840 850
CLNKSFIQEL RKDKFNPVNQ PKESSRSTGS SSGVQKAVTR TKRPGLMTKY
860 870
STSKKIKPNN PKHTLDIFFK
Length:870
Mass (Da):98,809
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i40CB259A65F6A796
GO
Isoform 2 (identifier: Q9UBT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-472: GRTVTIKLKNVNFEVKTRAS → VLYFDMVSLVFKFFNSKMLP
     473-870: Missing.

Note: No experimental confirmation available.
Show »
Length:472
Mass (Da):54,132
Checksum:i45D26D63D90D0225
GO
Isoform 3 (identifier: Q9UBT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-509: Missing.

Show »
Length:672
Mass (Da):76,454
Checksum:iD5BADE5559C88977
GO
Isoform 4 (identifier: Q9UBT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     453-462: GRTVTIKLKN → KKYLPLLRNC
     463-870: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:372
Mass (Da):42,487
Checksum:iFFDC64B0DC9D2A35
GO
Isoform 5 (identifier: Q9UBT6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-489: GRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAK → VFGYLVFPMKRTGNTNKGALLAFYRLETKPCQPLSVH
     490-870: Missing.

Show »
Length:489
Mass (Da):55,904
Checksum:iB3EA53A1890A1C9E
GO
Isoform 6 (identifier: Q9UBT6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-461: GRTVTIKLK → VAQVEYRRL
     462-870: Missing.

Show »
Length:461
Mass (Da):52,839
Checksum:iF2D33767C82284BD
GO
Isoform 7 (identifier: Q9UBT6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     453-461: GRTVTIKLK → VAQVEYRRL
     462-870: Missing.

Show »
Length:371
Mass (Da):42,372
Checksum:iB72DA3E0F14FD870
GO
Isoform 8 (identifier: Q9UBT6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.

Show »
Length:780
Mass (Da):88,342
Checksum:iE36919BC4E7D4C84
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RDX9D6RDX9_HUMAN
DNA polymerase kappa
POLK
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAE5D6RAE5_HUMAN
DNA polymerase kappa
POLK hCG_18353
396Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9M8D6R9M8_HUMAN
DNA polymerase kappa
POLK
427Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAI7D6RAI7_HUMAN
DNA polymerase kappa
POLK
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti21L → F in BAB58975 (Ref. 11) Curated1
Sequence conflicti39I → T in BAB58975 (Ref. 11) Curated1
Sequence conflicti219R → L in BAB58976 (Ref. 11) Curated1
Sequence conflicti342V → G in BAC03714 (PubMed:14702039).Curated1
Sequence conflicti557K → N in AAF23270 (Ref. 4) Curated1
Sequence conflicti847M → V in AAF23270 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048886423S → R. Corresponds to variant dbSNP:rs35257416Ensembl.1
Natural variantiVAR_021246595T → I1 PublicationCorresponds to variant dbSNP:rs5744713Ensembl.1
Natural variantiVAR_021247612I → V. Corresponds to variant dbSNP:rs3822587Ensembl.1
Natural variantiVAR_048887635S → N. Corresponds to variant dbSNP:rs35501530Ensembl.1
Natural variantiVAR_021248832S → N1 PublicationCorresponds to variant dbSNP:rs5744716Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0128041 – 90Missing in isoform 4, isoform 7 and isoform 8. 2 PublicationsAdd BLAST90
Alternative sequenceiVSP_012803312 – 509Missing in isoform 3. 1 PublicationAdd BLAST198
Alternative sequenceiVSP_053406453 – 489GRTVT…FAIAK → VFGYLVFPMKRTGNTNKGAL LAFYRLETKPCQPLSVH in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_012801453 – 472GRTVT…KTRAS → VLYFDMVSLVFKFFNSKMLP in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_012805453 – 462GRTVTIKLKN → KKYLPLLRNC in isoform 4. 1 Publication10
Alternative sequenceiVSP_053407453 – 461GRTVTIKLK → VAQVEYRRL in isoform 6 and isoform 7. 1 Publication9
Alternative sequenceiVSP_053408462 – 870Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST409
Alternative sequenceiVSP_012806463 – 870Missing in isoform 4. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_012802473 – 870Missing in isoform 2. 1 PublicationAdd BLAST398
Alternative sequenceiVSP_053409490 – 870Missing in isoform 5. 1 PublicationAdd BLAST381

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB027564 mRNA Translation: BAA86943.1
AF163570 mRNA Translation: AAF02540.1
AY769929 mRNA Translation: AAV80827.1
AY769931 mRNA Translation: AAV80829.1
AY769930 mRNA Translation: AAV80828.1
AY769932 mRNA Translation: AAV80830.1
AF194973 mRNA Translation: AAF23270.1
AF315602 mRNA Translation: AAN15780.1
AF318313 mRNA Translation: AAN15781.1
AK091659 mRNA Translation: BAC03714.1
AK314610 mRNA Translation: BAG37179.1
AY273797 Genomic DNA Translation: AAP12648.1
AC010245 Genomic DNA No translation available.
AC026424 Genomic DNA No translation available.
AC116341 Genomic DNA No translation available.
CH471084 Genomic DNA Translation: EAW95763.1
BC014955 mRNA Translation: AAH14955.1
BC050718 mRNA Translation: AAH50718.1
AB036934 Genomic DNA Translation: BAB58975.1
AB036935 Genomic DNA Translation: BAB58976.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4030.1 [Q9UBT6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001332851.1, NM_001345922.1 [Q9UBT6-8]
NP_057302.1, NM_016218.3 [Q9UBT6-1]
XP_016865048.1, XM_017009559.1 [Q9UBT6-1]
XP_016865049.1, XM_017009560.1 [Q9UBT6-1]
XP_016865052.1, XM_017009563.1 [Q9UBT6-8]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.135756

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000241436; ENSP00000241436; ENSG00000122008 [Q9UBT6-1]
ENST00000504026; ENSP00000425075; ENSG00000122008 [Q9UBT6-6]
ENST00000508526; ENSP00000426853; ENSG00000122008 [Q9UBT6-3]
ENST00000509126; ENSP00000423532; ENSG00000122008 [Q9UBT6-5]
ENST00000510815; ENSP00000422094; ENSG00000122008 [Q9UBT6-4]
ENST00000515295; ENSP00000424174; ENSG00000122008 [Q9UBT6-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51426

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51426

UCSC genome browser

More...
UCSCi
uc003kdw.4 human [Q9UBT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027564 mRNA Translation: BAA86943.1
AF163570 mRNA Translation: AAF02540.1
AY769929 mRNA Translation: AAV80827.1
AY769931 mRNA Translation: AAV80829.1
AY769930 mRNA Translation: AAV80828.1
AY769932 mRNA Translation: AAV80830.1
AF194973 mRNA Translation: AAF23270.1
AF315602 mRNA Translation: AAN15780.1
AF318313 mRNA Translation: AAN15781.1
AK091659 mRNA Translation: BAC03714.1
AK314610 mRNA Translation: BAG37179.1
AY273797 Genomic DNA Translation: AAP12648.1
AC010245 Genomic DNA No translation available.
AC026424 Genomic DNA No translation available.
AC116341 Genomic DNA No translation available.
CH471084 Genomic DNA Translation: EAW95763.1
BC014955 mRNA Translation: AAH14955.1
BC050718 mRNA Translation: AAH50718.1
AB036934 Genomic DNA Translation: BAB58975.1
AB036935 Genomic DNA Translation: BAB58976.1
CCDSiCCDS4030.1 [Q9UBT6-1]
RefSeqiNP_001332851.1, NM_001345922.1 [Q9UBT6-8]
NP_057302.1, NM_016218.3 [Q9UBT6-1]
XP_016865048.1, XM_017009559.1 [Q9UBT6-1]
XP_016865049.1, XM_017009560.1 [Q9UBT6-1]
XP_016865052.1, XM_017009563.1 [Q9UBT6-8]
UniGeneiHs.135756

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1T94X-ray2.40A/B68-526[»]
2LSINMR-B562-577[»]
2OH2X-ray3.05A/B19-526[»]
2W7OX-ray3.16A/B19-526[»]
2W7PX-ray3.71A/B19-526[»]
3IN5X-ray3.20A/B19-526[»]
3PZPX-ray3.34A/B19-528[»]
4BA9X-ray2.73A/B/C/D/E/F563-575[»]
4GK5X-ray3.21G564-573[»]
4U6PX-ray2.59A/B1-526[»]
4U7CX-ray2.80A/B27-518[»]
5T14X-ray3.00A/B1-527[»]
5W2AX-ray2.90A/B1-526[»]
5W2CX-ray2.50A/B1-526[»]
6BRXX-ray2.80A/B1-526[»]
6BS1X-ray3.15A/B1-526[»]
ProteinModelPortaliQ9UBT6
SMRiQ9UBT6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119532, 44 interactors
CORUMiQ9UBT6
IntActiQ9UBT6, 26 interactors
STRINGi9606.ENSP00000241436

Chemistry databases

BindingDBiQ9UBT6
ChEMBLiCHEMBL5365
DrugBankiDB08237 2'-deoxy-N-(naphthalen-1-ylmethyl)guanosine 5'-(dihydrogen phosphate)

PTM databases

iPTMnetiQ9UBT6
PhosphoSitePlusiQ9UBT6

Polymorphism and mutation databases

BioMutaiPOLK
DMDMi59798438

Proteomic databases

EPDiQ9UBT6
PaxDbiQ9UBT6
PeptideAtlasiQ9UBT6
PRIDEiQ9UBT6
ProteomicsDBi84057
84058 [Q9UBT6-2]
84059 [Q9UBT6-3]
84060 [Q9UBT6-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241436; ENSP00000241436; ENSG00000122008 [Q9UBT6-1]
ENST00000504026; ENSP00000425075; ENSG00000122008 [Q9UBT6-6]
ENST00000508526; ENSP00000426853; ENSG00000122008 [Q9UBT6-3]
ENST00000509126; ENSP00000423532; ENSG00000122008 [Q9UBT6-5]
ENST00000510815; ENSP00000422094; ENSG00000122008 [Q9UBT6-4]
ENST00000515295; ENSP00000424174; ENSG00000122008 [Q9UBT6-2]
GeneIDi51426
KEGGihsa:51426
UCSCiuc003kdw.4 human [Q9UBT6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51426
DisGeNETi51426
EuPathDBiHostDB:ENSG00000122008.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
POLK
HGNCiHGNC:9183 POLK
HPAiHPA012035
HPA057303
HPA068117
HPA069375
MalaCardsiPOLK
MIMi605650 gene
neXtProtiNX_Q9UBT6
OpenTargetsiENSG00000122008
PharmGKBiPA33503

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2094 Eukaryota
COG0389 LUCA
GeneTreeiENSGT00940000156667
HOGENOMiHOG000082711
HOVERGENiHBG101212
InParanoidiQ9UBT6
KOiK03511
OMAiHVDACLD
OrthoDBiEOG091G0679
PhylomeDBiQ9UBT6
TreeFamiTF314387

Enzyme and pathway databases

ReactomeiR-HSA-5655862 Translesion synthesis by POLK
R-HSA-5656169 Termination of translesion DNA synthesis
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5696397 Gap-filling DNA repair synthesis and ligation in GG-NER
R-HSA-5696400 Dual Incision in GG-NER
R-HSA-6782135 Dual incision in TC-NER
R-HSA-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
POLK human
EvolutionaryTraceiQ9UBT6

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
POLK

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51426

Protein Ontology

More...
PROi
PR:Q9UBT6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000122008 Expressed in 202 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ9UBT6 baseline and differential
GenevisibleiQ9UBT6 HS

Family and domain databases

CDDicd03586 PolY_Pol_IV_kappa, 1 hit
Gene3Di3.30.1490.100, 1 hit
HAMAPiMF_01113 DNApol_IV, 1 hit
InterProiView protein in InterPro
IPR036775 DNA_pol_Y-fam_lit_finger_sf
IPR017961 DNA_pol_Y-fam_little_finger
IPR022880 DNApol_IV
IPR024728 PolY_HhH_motif
IPR001126 UmuC
IPR006642 Znf_Rad18_put
PfamiView protein in Pfam
PF00817 IMS, 1 hit
PF11799 IMS_C, 1 hit
PF11798 IMS_HHH, 1 hit
SMARTiView protein in SMART
SM00734 ZnF_Rad18, 2 hits
SUPFAMiSSF100879 SSF100879, 1 hit
PROSITEiView protein in PROSITE
PS50173 UMUC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPOLK_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBT6
Secondary accession number(s): B2RBD2
, Q5Q9G5, Q5Q9G6, Q5Q9G7, Q5Q9G8, Q86VJ8, Q8IZY0, Q8IZY1, Q8NB30, Q96L01, Q96Q86, Q96Q87, Q9UHC5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: May 1, 2000
Last modified: December 5, 2018
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again