Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q9UBP9 (GULP1_HUMAN)

Entry version 149 (07 Apr 2021)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

PTB domain-containing engulfment adapter protein 1

Gene

GULP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization and endosomal trafficking of various LRP1 ligands, such as PSAP. Increases cellular levels of GTP-bound ARF6.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Lipid transport, Phagocytosis, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UBP9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PTB domain-containing engulfment adapter protein 1
Alternative name(s):
Cell death protein 6 homolog
PTB domain adapter protein CED-6
Protein GULP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GULP1
Synonyms:CED6, GULP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:18649, GULP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608165, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UBP9

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000144366.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi176L → P: Loss of dimerization; when associated with P-183. 1 Publication1
Mutagenesisi183L → P: Loss of dimerization; when associated with P-176. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		51454

Open Targets

More...OpenTargetsi		ENSG00000144366

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134993283

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UBP9, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GULP1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74720076

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002966791 – 304PTB domain-containing engulfment adapter protein 1Add BLAST304

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei16PhosphothreonineCombined sources1
Modified residuei223PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UBP9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UBP9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UBP9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UBP9

PeptideAtlas

More...PeptideAtlasi		Q9UBP9

PRoteomics IDEntifications database

More...PRIDEi		Q9UBP9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		19167
7320
84028 [Q9UBP9-1]
84029 [Q9UBP9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UBP9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UBP9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000144366, Expressed in chorionic villus and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UBP9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UBP9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000144366, Tissue enhanced (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with clathrin.

Interacts with GDP-bound ARF6, but not with GTP-bound ARF6.

Part of a complex composed of GULP1, ACAP1 and ARF6.

Interacts with ACAP1, LRP1, MEGF10 and STAB2.

5 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119550, 19 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q9UBP9

Protein interaction database and analysis system

More...IntActi		Q9UBP9, 10 interactors

Molecular INTeraction database

More...MINTi		Q9UBP9

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000386289

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UBP9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1304
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UBP9

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini21 – 176PIDPROSITE-ProRule annotationAdd BLAST156

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili158 – 202Sequence analysisAdd BLAST45

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ced-6 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3536, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156186

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_024530_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UBP9

Identification of Orthologs from Complete Genome Data

More...OMAi		CLDPVDS

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UBP9

TreeFam database of animal gene trees

More...TreeFami		TF314159

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00640, PID, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00462, PTB, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01179, PID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBP9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRAFSRKKD KTWMHTPEAL SKHFIPYNAK FLGSTEVEQP KGTEVVRDAV 
        60         70         80         90        100
RKLKFARHIK KSEGQKIPKV ELQISIYGVK ILEPKTKEVQ HNCQLHRISF 
       110        120        130        140        150
CADDKTDKRI FTFICKDSES NKHLCYVFDS EKCAEEITLT IGQAFDLAYR 
       160        170        180        190        200
KFLESGGKDV ETRKQIAGLQ KRIQDLETEN MELKNKVQDL ENQLRITQVS 
       210        220        230        240        250
APPAGSMTPK SPSTDIFDMI PFSPISHQSS MPTRNGTQPP PVPSRSTEIK 
       260        270        280        290        300
RDLFGAEPFD PFNCGAADFP PDIQSKLDEM QEGFKMGLTL EGTVFCLDPL 

DSRC
Length:304
Mass (Da):34,490
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6FCDE040073DBE8B
GO
Isoform 2 (identifier: Q9UBP9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     134-167: AEEITLTIGQAFDLAYRKFLESGGKDVETRKQIA → VSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL
     168-304: Missing.

Show »
Length:167
Mass (Da):19,423
Checksum:i6A33DC720CB9A2DE
GO
Isoform 3 (identifier: Q9UBP9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     31-133: Missing.

Show »
Length:201
Mass (Da):22,567
Checksum:i139143B94E5121C4
GO
Isoform 4 (identifier: Q9UBP9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     282-304: EGFKMGLTLEGTVFCLDPLDSRC → RQRWRGSKWD

Show »
Length:291
Mass (Da):33,333
Checksum:i2736C095A6140AB5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y6R1H0Y6R1_HUMAN
PTB domain-containing engulfment ad...
GULP1
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZV7H7BZV7_HUMAN
PTB domain-containing engulfment ad...
GULP1
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8ZZL1B8ZZL1_HUMAN
PTB domain-containing engulfment ad...
GULP1
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti292G → S in BAG60802 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04470331 – 133Missing in isoform 3. 1 PublicationAdd BLAST103
Alternative sequenceiVSP_027250134 – 167AEEIT…RKQIA → VSIPDVVGWFVLFYKPGIVL LLALAKYLKMNNFL in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_027251168 – 304Missing in isoform 2. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_045540282 – 304EGFKM…LDSRC → RQRWRGSKWD in isoform 4. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF200715 mRNA Translation: AAF08006.1
AF191771 mRNA Translation: AAF18975.1
AK055718 mRNA No translation available.
AK298626 mRNA Translation: BAG60802.1
AK314498 mRNA Translation: BAG37098.1
AC092598 Genomic DNA Translation: AAX93242.1
AC125490 Genomic DNA Translation: AAY24122.1
AC104131 Genomic DNA No translation available.
AC108493 Genomic DNA No translation available.
AC133606 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX10913.1
CH471058 Genomic DNA Translation: EAX10914.1
CH471058 Genomic DNA Translation: EAX10915.1
CH471058 Genomic DNA Translation: EAX10917.1
BC001103 mRNA Translation: AAH01103.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2295.1 [Q9UBP9-1]
CCDS58742.1 [Q9UBP9-4]
CCDS58743.1 [Q9UBP9-3]

NCBI Reference Sequences

More...RefSeqi		NP_001239597.1, NM_001252668.1 [Q9UBP9-4]
NP_001239598.1, NM_001252669.1 [Q9UBP9-3]
NP_057399.1, NM_016315.3 [Q9UBP9-1]
XP_016859795.1, XM_017004306.1 [Q9UBP9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000359135; ENSP00000352047; ENSG00000144366 [Q9UBP9-1]
ENST00000409580; ENSP00000386289; ENSG00000144366 [Q9UBP9-1]
ENST00000409609; ENSP00000386867; ENSG00000144366 [Q9UBP9-1]
ENST00000409637; ENSP00000386402; ENSG00000144366 [Q9UBP9-2]
ENST00000409805; ENSP00000387171; ENSG00000144366 [Q9UBP9-3]
ENST00000409830; ENSP00000386732; ENSG00000144366 [Q9UBP9-1]
ENST00000409843; ENSP00000387144; ENSG00000144366 [Q9UBP9-4]
ENST00000410051; ENSP00000387013; ENSG00000144366 [Q9UBP9-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		51454

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:51454

UCSC genome browser

More...UCSCi		uc002uqc.5, human [Q9UBP9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF200715 mRNA Translation: AAF08006.1
AF191771 mRNA Translation: AAF18975.1
AK055718 mRNA No translation available.
AK298626 mRNA Translation: BAG60802.1
AK314498 mRNA Translation: BAG37098.1
AC092598 Genomic DNA Translation: AAX93242.1
AC125490 Genomic DNA Translation: AAY24122.1
AC104131 Genomic DNA No translation available.
AC108493 Genomic DNA No translation available.
AC133606 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX10913.1
CH471058 Genomic DNA Translation: EAX10914.1
CH471058 Genomic DNA Translation: EAX10915.1
CH471058 Genomic DNA Translation: EAX10917.1
BC001103 mRNA Translation: AAH01103.1
CCDSiCCDS2295.1 [Q9UBP9-1]
CCDS58742.1 [Q9UBP9-4]
CCDS58743.1 [Q9UBP9-3]
RefSeqiNP_001239597.1, NM_001252668.1 [Q9UBP9-4]
NP_001239598.1, NM_001252669.1 [Q9UBP9-3]
NP_057399.1, NM_016315.3 [Q9UBP9-1]
XP_016859795.1, XM_017004306.1 [Q9UBP9-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6ITUX-ray2.17A1-168[»]
SMRiQ9UBP9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi119550, 19 interactors
ELMiQ9UBP9
IntActiQ9UBP9, 10 interactors
MINTiQ9UBP9
STRINGi9606.ENSP00000386289

PTM databases

iPTMnetiQ9UBP9
PhosphoSitePlusiQ9UBP9

Genetic variation databases

BioMutaiGULP1
DMDMi74720076

Proteomic databases

EPDiQ9UBP9
jPOSTiQ9UBP9
MassIVEiQ9UBP9
PaxDbiQ9UBP9
PeptideAtlasiQ9UBP9
PRIDEiQ9UBP9
ProteomicsDBi19167
7320
84028 [Q9UBP9-1]
84029 [Q9UBP9-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19788, 190 antibodies

The DNASU plasmid repository

More...DNASUi		51454

Genome annotation databases

EnsembliENST00000359135; ENSP00000352047; ENSG00000144366 [Q9UBP9-1]
ENST00000409580; ENSP00000386289; ENSG00000144366 [Q9UBP9-1]
ENST00000409609; ENSP00000386867; ENSG00000144366 [Q9UBP9-1]
ENST00000409637; ENSP00000386402; ENSG00000144366 [Q9UBP9-2]
ENST00000409805; ENSP00000387171; ENSG00000144366 [Q9UBP9-3]
ENST00000409830; ENSP00000386732; ENSG00000144366 [Q9UBP9-1]
ENST00000409843; ENSP00000387144; ENSG00000144366 [Q9UBP9-4]
ENST00000410051; ENSP00000387013; ENSG00000144366 [Q9UBP9-2]
GeneIDi51454
KEGGihsa:51454
UCSCiuc002uqc.5, human [Q9UBP9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51454
DisGeNETi51454

GeneCards: human genes, protein and diseases

More...GeneCardsi		GULP1
HGNCiHGNC:18649, GULP1
HPAiENSG00000144366, Tissue enhanced (placenta)
MIMi608165, gene
neXtProtiNX_Q9UBP9
OpenTargetsiENSG00000144366
PharmGKBiPA134993283
VEuPathDBiHostDB:ENSG00000144366.15

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3536, Eukaryota
GeneTreeiENSGT00940000156186
HOGENOMiCLU_024530_0_0_1
InParanoidiQ9UBP9
OMAiCLDPVDS
PhylomeDBiQ9UBP9
TreeFamiTF314159

Enzyme and pathway databases

PathwayCommonsiQ9UBP9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		51454, 7 hits in 996 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GULP1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		51454
PharosiQ9UBP9, Tbio

Protein Ontology

More...PROi		PR:Q9UBP9
RNActiQ9UBP9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000144366, Expressed in chorionic villus and 239 other tissues
ExpressionAtlasiQ9UBP9, baseline and differential
GenevisibleiQ9UBP9, HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
PfamiView protein in Pfam
PF00640, PID, 1 hit
SMARTiView protein in SMART
SM00462, PTB, 1 hit
PROSITEiView protein in PROSITE
PS01179, PID, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGULP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBP9
Secondary accession number(s): B2RB51
, B4DQ40, B8ZZ72, D3DPH1, E9PB86, Q53PC1, Q53RF3, Q9BVL3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: May 1, 2000
Last modified: April 7, 2021
This is version 149 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again