Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PTB domain-containing engulfment adapter protein 1

Gene

GULP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization and endosomal trafficking of various LRP1 ligands, such as PSAP. Increases cellular levels of GTP-bound ARF6.4 Publications

GO - Biological processi

  • apoptotic process Source: ProtInc
  • lipid transport Source: UniProtKB-KW
  • phagocytosis, engulfment Source: MGI

Keywordsi

Biological processApoptosis, Lipid transport, Phagocytosis, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
PTB domain-containing engulfment adapter protein 1
Alternative name(s):
Cell death protein 6 homolog
PTB domain adapter protein CED-6
Protein GULP
Gene namesi
Name:GULP1
Synonyms:CED6, GULP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000144366.15
HGNCiHGNC:18649 GULP1
MIMi608165 gene
neXtProtiNX_Q9UBP9

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi176L → P: Loss of dimerization; when associated with P-183. 1 Publication1
Mutagenesisi183L → P: Loss of dimerization; when associated with P-176. 1 Publication1

Organism-specific databases

DisGeNETi51454
OpenTargetsiENSG00000144366
PharmGKBiPA134993283

Polymorphism and mutation databases

BioMutaiGULP1
DMDMi74720076

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002966791 – 304PTB domain-containing engulfment adapter protein 1Add BLAST304

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei16PhosphothreonineCombined sources1
Modified residuei223PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UBP9
PaxDbiQ9UBP9
PeptideAtlasiQ9UBP9
PRIDEiQ9UBP9
ProteomicsDBi84028
84029 [Q9UBP9-2]

PTM databases

iPTMnetiQ9UBP9
PhosphoSitePlusiQ9UBP9

Expressioni

Tissue specificityi

Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary.1 Publication

Gene expression databases

BgeeiENSG00000144366
CleanExiHS_GULP1
ExpressionAtlasiQ9UBP9 baseline and differential
GenevisibleiQ9UBP9 HS

Organism-specific databases

HPAiHPA020587

Interactioni

Subunit structurei

Homodimer. Interacts with clathrin. Interacts with GDP-bound ARF6, but not with GTP-bound ARF6. Part of a complex composed of GULP1, ACAP1 and ARF6. Interacts with ACAP1, LRP1, MEGF10 and STAB2.5 Publications

Protein-protein interaction databases

BioGridi119550, 12 interactors
ELMiQ9UBP9
IntActiQ9UBP9, 8 interactors
MINTiQ9UBP9
STRINGi9606.ENSP00000352047

Structurei

3D structure databases

ProteinModelPortaliQ9UBP9
SMRiQ9UBP9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini21 – 176PIDPROSITE-ProRule annotationAdd BLAST156

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili158 – 202Sequence analysisAdd BLAST45

Sequence similaritiesi

Belongs to the ced-6 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3536 Eukaryota
ENOG410ZHJT LUCA
GeneTreeiENSGT00530000062937
HOGENOMiHOG000039986
HOVERGENiHBG056801
InParanoidiQ9UBP9
OMAiPFDPFSC
OrthoDBiEOG091G0F2O
PhylomeDBiQ9UBP9
TreeFamiTF314159

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
PfamiView protein in Pfam
PF00640 PID, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UBP9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRAFSRKKD KTWMHTPEAL SKHFIPYNAK FLGSTEVEQP KGTEVVRDAV
60 70 80 90 100
RKLKFARHIK KSEGQKIPKV ELQISIYGVK ILEPKTKEVQ HNCQLHRISF
110 120 130 140 150
CADDKTDKRI FTFICKDSES NKHLCYVFDS EKCAEEITLT IGQAFDLAYR
160 170 180 190 200
KFLESGGKDV ETRKQIAGLQ KRIQDLETEN MELKNKVQDL ENQLRITQVS
210 220 230 240 250
APPAGSMTPK SPSTDIFDMI PFSPISHQSS MPTRNGTQPP PVPSRSTEIK
260 270 280 290 300
RDLFGAEPFD PFNCGAADFP PDIQSKLDEM QEGFKMGLTL EGTVFCLDPL

DSRC
Length:304
Mass (Da):34,490
Last modified:May 1, 2000 - v1
Checksum:i6FCDE040073DBE8B
GO
Isoform 2 (identifier: Q9UBP9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     134-167: AEEITLTIGQAFDLAYRKFLESGGKDVETRKQIA → VSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL
     168-304: Missing.

Show »
Length:167
Mass (Da):19,423
Checksum:i6A33DC720CB9A2DE
GO
Isoform 3 (identifier: Q9UBP9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     31-133: Missing.

Note: No experimental confirmation available.
Show »
Length:201
Mass (Da):22,567
Checksum:i139143B94E5121C4
GO
Isoform 4 (identifier: Q9UBP9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     282-304: EGFKMGLTLEGTVFCLDPLDSRC → RQRWRGSKWD

Note: No experimental confirmation available.
Show »
Length:291
Mass (Da):33,333
Checksum:i2736C095A6140AB5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti292G → S in BAG60802 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04470331 – 133Missing in isoform 3. 1 PublicationAdd BLAST103
Alternative sequenceiVSP_027250134 – 167AEEIT…RKQIA → VSIPDVVGWFVLFYKPGIVL LLALAKYLKMNNFL in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_027251168 – 304Missing in isoform 2. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_045540282 – 304EGFKM…LDSRC → RQRWRGSKWD in isoform 4. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF200715 mRNA Translation: AAF08006.1
AF191771 mRNA Translation: AAF18975.1
AK055718 mRNA No translation available.
AK298626 mRNA Translation: BAG60802.1
AK314498 mRNA Translation: BAG37098.1
AC092598 Genomic DNA Translation: AAX93242.1
AC125490 Genomic DNA Translation: AAY24122.1
AC104131 Genomic DNA No translation available.
AC108493 Genomic DNA No translation available.
AC133606 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX10913.1
CH471058 Genomic DNA Translation: EAX10914.1
CH471058 Genomic DNA Translation: EAX10915.1
CH471058 Genomic DNA Translation: EAX10917.1
BC001103 mRNA Translation: AAH01103.1
CCDSiCCDS2295.1 [Q9UBP9-1]
CCDS58742.1 [Q9UBP9-4]
CCDS58743.1 [Q9UBP9-3]
RefSeqiNP_001239597.1, NM_001252668.1 [Q9UBP9-4]
NP_001239598.1, NM_001252669.1 [Q9UBP9-3]
NP_057399.1, NM_016315.3 [Q9UBP9-1]
XP_016859795.1, XM_017004306.1 [Q9UBP9-1]
UniGeneiHs.470887
Hs.712910

Genome annotation databases

EnsembliENST00000359135; ENSP00000352047; ENSG00000144366 [Q9UBP9-1]
ENST00000409580; ENSP00000386289; ENSG00000144366 [Q9UBP9-1]
ENST00000409609; ENSP00000386867; ENSG00000144366 [Q9UBP9-1]
ENST00000409637; ENSP00000386402; ENSG00000144366 [Q9UBP9-2]
ENST00000409805; ENSP00000387171; ENSG00000144366 [Q9UBP9-3]
ENST00000409830; ENSP00000386732; ENSG00000144366 [Q9UBP9-1]
ENST00000409843; ENSP00000387144; ENSG00000144366 [Q9UBP9-4]
ENST00000410051; ENSP00000387013; ENSG00000144366 [Q9UBP9-2]
GeneIDi51454
KEGGihsa:51454
UCSCiuc002uqc.5 human [Q9UBP9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiGULP1_HUMAN
AccessioniPrimary (citable) accession number: Q9UBP9
Secondary accession number(s): B2RB51
, B4DQ40, B8ZZ72, D3DPH1, E9PB86, Q53PC1, Q53RF3, Q9BVL3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: May 1, 2000
Last modified: July 18, 2018
This is version 129 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health