Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (11 Dec 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C

Gene

MGAT4C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains (By similarity). Does not catalyze the transfer of GlcNAc to the Manalpha1-6 arm to form GlcNAcBeta1-4Manalpha1-6 linkage ('GnT-VI' activity).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationBy similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase
LigandMetal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS00017-MONOMER

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-975577 N-Glycan antennae elongation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00378

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
GT54 Glycosyltransferase Family 54

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C (EC:2.4.1.145)
Alternative name(s):
N-acetylglucosaminyltransferase IV homolog
Short name:
hGnT-IV-H
N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVc
Short name:
GlcNAc-T IVc
Short name:
GnT-IVc
Short name:
N-acetylglucosaminyltransferase IVc
UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVc
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MGAT4C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000182050.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30871 MGAT4C

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607385 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UBM8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 23CytoplasmicSequence analysisAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei24 – 44Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini45 – 478LumenalSequence analysisAdd BLAST434

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
25834

Open Targets

More...
OpenTargetsi
ENSG00000182050

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485535

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UBM8 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MGAT4C

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296437368

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002885961 – 478Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase CAdd BLAST478

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi84N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi215N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UBM8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UBM8

PeptideAtlas

More...
PeptideAtlasi
Q9UBM8

PRoteomics IDEntifications database

More...
PRIDEi
Q9UBM8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
84010 [Q9UBM8-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UBM8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UBM8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, adrenal gland, testis, liver, brain and fetal brain. Not expressed in pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182050 Expressed in 98 organ(s), highest expression level in heart

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UBM8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UBM8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA016418

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117362, 39 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UBM8, 37 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000481096

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9UBM8 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyltransferase 54 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410II76 Eukaryota
ENOG410XPSP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155352

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000070065

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UBM8

KEGG Orthology (KO)

More...
KOi
K13748

Identification of Orthologs from Complete Genome Data

More...
OMAi
CLLFMNL

Database of Orthologous Groups

More...
OrthoDBi
593094at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UBM8

TreeFam database of animal gene trees

More...
TreeFami
TF324570

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.260, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008979 Galactose-bd-like_sf
IPR006759 Glyco_transf_54

The PANTHER Classification System

More...
PANTHERi
PTHR12062 PTHR12062, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBM8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFKFHQMKHI FEILDKMRCL RKRSTVSFLG VLVIFLLFMN LYIEDSYVLE
60 70 80 90 100
GDKQLIRETS THQLNSERYV HTFKDLSNFS GAINVTYRYL AATPLQRKRY
110 120 130 140 150
LTIGLSSVKR KKGNYLLETI KSIFEQSSYE ELKEISVVVH LADFNSSWRD
160 170 180 190 200
AMVQDITQKF AHHIIAGRLM VIHAPEEYYP ILDGLKRNYN DPEDRVKFRS
210 220 230 240 250
KQNVDYAFLL NFCANTSDYY VMLEDDVRCS KNFLTAIKKV IASLEGTYWV
260 270 280 290 300
TLEFSKLGYI GKLYHSHDLP RLAHFLLMFY QEMPCDWLLT HFRGLLAQKN
310 320 330 340 350
VIRFKPSLFQ HMGYYSSYKG TENKLKDDDF EEESFDIPDN PPASLYTNMN
360 370 380 390 400
VFENYEASKA YSSVDEYFWG KPPSTGDVFV IVFENPIIIK KIKVNTGTED
410 420 430 440 450
RQNDILHHGA LDVGENVMPS KQRRQCSTYL RLGEFKNGNF EMSGVNQKIP
460 470
FDIHCMRIYV TKTQKEWLII RSISIWTS
Length:478
Mass (Da):56,061
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7D09A1BB6B6800C6
GO
Isoform 2 (identifier: Q9UBM8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLGKDMVRFVVRKTVQRSVAKGSRRCKKRM

Show »
Length:507
Mass (Da):59,465
Checksum:iA73FDA660E5A71C3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VTY5F8VTY5_HUMAN
Alpha-1,3-mannosyl-glycoprotein 4-b...
MGAT4C
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VWY2F8VWY2_HUMAN
Alpha-1,3-mannosyl-glycoprotein 4-b...
MGAT4C
397Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH26068 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032447428T → S2 PublicationsCorresponds to variant dbSNP:rs17855890Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0560961M → MLGKDMVRFVVRKTVQRSVA KGSRRCKKRM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB024729 mRNA Translation: BAA83074.1
AB024730 mRNA Translation: BAA83075.1
AB024911 Genomic DNA Translation: BAA83087.1
AK299253 mRNA Translation: BAG61284.1
AC010196 Genomic DNA No translation available.
AC016993 Genomic DNA No translation available.
AC025157 Genomic DNA No translation available.
AC079596 Genomic DNA No translation available.
AC079865 Genomic DNA No translation available.
AC087887 Genomic DNA No translation available.
AC093122 Genomic DNA No translation available.
AC128681 Genomic DNA No translation available.
AC139663 Genomic DNA No translation available.
AC139697 Genomic DNA No translation available.
BC026068 mRNA Translation: AAH26068.1 Sequence problems.
BC064141 mRNA Translation: AAH64141.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9030.1 [Q9UBM8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_037376.2, NM_013244.3 [Q9UBM8-1]
XP_005268833.1, XM_005268776.4
XP_005268836.1, XM_005268779.3
XP_011536458.1, XM_011538156.2
XP_011536459.1, XM_011538157.2
XP_016874634.1, XM_017019145.1
XP_016874635.1, XM_017019146.1 [Q9UBM8-2]
XP_016874636.1, XM_017019147.1
XP_016874637.1, XM_017019148.1
XP_016874638.1, XM_017019149.1
XP_016874639.1, XM_017019150.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000548651; ENSP00000447253; ENSG00000182050 [Q9UBM8-1]
ENST00000552808; ENSP00000446647; ENSG00000182050 [Q9UBM8-1]
ENST00000611864; ENSP00000481096; ENSG00000182050 [Q9UBM8-1]
ENST00000620241; ENSP00000477650; ENSG00000182050 [Q9UBM8-1]
ENST00000621808; ENSP00000478300; ENSG00000182050 [Q9UBM8-1]
ENST00000636211; ENSP00000489618; ENSG00000283530 [Q9UBM8-1]
ENST00000636626; ENSP00000490784; ENSG00000283530 [Q9UBM8-1]
ENST00000637362; ENSP00000490416; ENSG00000283530 [Q9UBM8-1]
ENST00000637661; ENSP00000489751; ENSG00000283530 [Q9UBM8-1]
ENST00000638103; ENSP00000490547; ENSG00000283530 [Q9UBM8-1]
ENST00000643295; ENSP00000495724; ENSG00000285137 [Q9UBM8-1]
ENST00000644829; ENSP00000496716; ENSG00000285137 [Q9UBM8-1]
ENST00000645144; ENSP00000494369; ENSG00000285137 [Q9UBM8-1]
ENST00000646486; ENSP00000495039; ENSG00000285137 [Q9UBM8-1]
ENST00000646655; ENSP00000494764; ENSG00000285137 [Q9UBM8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25834

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25834

UCSC genome browser

More...
UCSCi
uc001tai.5 human [Q9UBM8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024729 mRNA Translation: BAA83074.1
AB024730 mRNA Translation: BAA83075.1
AB024911 Genomic DNA Translation: BAA83087.1
AK299253 mRNA Translation: BAG61284.1
AC010196 Genomic DNA No translation available.
AC016993 Genomic DNA No translation available.
AC025157 Genomic DNA No translation available.
AC079596 Genomic DNA No translation available.
AC079865 Genomic DNA No translation available.
AC087887 Genomic DNA No translation available.
AC093122 Genomic DNA No translation available.
AC128681 Genomic DNA No translation available.
AC139663 Genomic DNA No translation available.
AC139697 Genomic DNA No translation available.
BC026068 mRNA Translation: AAH26068.1 Sequence problems.
BC064141 mRNA Translation: AAH64141.1
CCDSiCCDS9030.1 [Q9UBM8-1]
RefSeqiNP_037376.2, NM_013244.3 [Q9UBM8-1]
XP_005268833.1, XM_005268776.4
XP_005268836.1, XM_005268779.3
XP_011536458.1, XM_011538156.2
XP_011536459.1, XM_011538157.2
XP_016874634.1, XM_017019145.1
XP_016874635.1, XM_017019146.1 [Q9UBM8-2]
XP_016874636.1, XM_017019147.1
XP_016874637.1, XM_017019148.1
XP_016874638.1, XM_017019149.1
XP_016874639.1, XM_017019150.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi117362, 39 interactors
IntActiQ9UBM8, 37 interactors
STRINGi9606.ENSP00000481096

Protein family/group databases

CAZyiGT54 Glycosyltransferase Family 54

PTM databases

iPTMnetiQ9UBM8
PhosphoSitePlusiQ9UBM8

Polymorphism and mutation databases

BioMutaiMGAT4C
DMDMi296437368

Proteomic databases

MassIVEiQ9UBM8
PaxDbiQ9UBM8
PeptideAtlasiQ9UBM8
PRIDEiQ9UBM8
ProteomicsDBi84010 [Q9UBM8-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
25834

Genome annotation databases

EnsembliENST00000548651; ENSP00000447253; ENSG00000182050 [Q9UBM8-1]
ENST00000552808; ENSP00000446647; ENSG00000182050 [Q9UBM8-1]
ENST00000611864; ENSP00000481096; ENSG00000182050 [Q9UBM8-1]
ENST00000620241; ENSP00000477650; ENSG00000182050 [Q9UBM8-1]
ENST00000621808; ENSP00000478300; ENSG00000182050 [Q9UBM8-1]
ENST00000636211; ENSP00000489618; ENSG00000283530 [Q9UBM8-1]
ENST00000636626; ENSP00000490784; ENSG00000283530 [Q9UBM8-1]
ENST00000637362; ENSP00000490416; ENSG00000283530 [Q9UBM8-1]
ENST00000637661; ENSP00000489751; ENSG00000283530 [Q9UBM8-1]
ENST00000638103; ENSP00000490547; ENSG00000283530 [Q9UBM8-1]
ENST00000643295; ENSP00000495724; ENSG00000285137 [Q9UBM8-1]
ENST00000644829; ENSP00000496716; ENSG00000285137 [Q9UBM8-1]
ENST00000645144; ENSP00000494369; ENSG00000285137 [Q9UBM8-1]
ENST00000646486; ENSP00000495039; ENSG00000285137 [Q9UBM8-1]
ENST00000646655; ENSP00000494764; ENSG00000285137 [Q9UBM8-1]
GeneIDi25834
KEGGihsa:25834
UCSCiuc001tai.5 human [Q9UBM8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25834
DisGeNETi25834
EuPathDBiHostDB:ENSG00000182050.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MGAT4C
HGNCiHGNC:30871 MGAT4C
HPAiHPA016418
MIMi607385 gene
neXtProtiNX_Q9UBM8
OpenTargetsiENSG00000182050
PharmGKBiPA143485535

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410II76 Eukaryota
ENOG410XPSP LUCA
GeneTreeiENSGT00940000155352
HOGENOMiHOG000070065
InParanoidiQ9UBM8
KOiK13748
OMAiCLLFMNL
OrthoDBi593094at2759
PhylomeDBiQ9UBM8
TreeFamiTF324570

Enzyme and pathway databases

UniPathwayiUPA00378
BioCyciMetaCyc:HS00017-MONOMER
ReactomeiR-HSA-975577 N-Glycan antennae elongation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MGAT4C human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25834
PharosiQ9UBM8 Tbio

Protein Ontology

More...
PROi
PR:Q9UBM8
RNActiQ9UBM8 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000182050 Expressed in 98 organ(s), highest expression level in heart
ExpressionAtlasiQ9UBM8 baseline and differential
GenevisibleiQ9UBM8 HS

Family and domain databases

Gene3Di2.60.120.260, 1 hit
InterProiView protein in InterPro
IPR008979 Galactose-bd-like_sf
IPR006759 Glyco_transf_54
PANTHERiPTHR12062 PTHR12062, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMGT4C_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBM8
Secondary accession number(s): B4DRH2, Q4G199, Q9UIU5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 18, 2010
Last modified: December 11, 2019
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again