Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UBM1 (PEMT_HUMAN)

Entry version 159 (16 Oct 2019)
Sequence version 4 (12 Jun 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Phosphatidylethanolamine N-methyltransferase

Gene

PEMT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the three sequential steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and PDME to phosphatidylcholine (PC).UniRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

The first methylation is rate-limiting.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: phosphatidylcholine biosynthesis

This protein is involved in the pathway phosphatidylcholine biosynthesis, which is part of Phospholipid metabolism.UniRule annotation
View all proteins of this organism that are known to be involved in the pathway phosphatidylcholine biosynthesis and in Phospholipid metabolism.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, Transferase
Biological processLipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.1.1.17 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1483191 Synthesis of PC

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00753

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001199 [Q9UBM1-1]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylethanolamine N-methyltransferaseUniRule annotation (EC:2.1.1.17UniRule annotation, EC:2.1.1.71UniRule annotation)
Short name:
PEAMTUniRule annotation
Short name:
PEMTUniRule annotation
Alternative name(s):
PEMT2
Phospholipid methyltransferaseUniRule annotation
Short name:
PLMTUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PEMTUniRule annotation
Synonyms:PEMPT, PNMT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8830 PEMT

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602391 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UBM1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 12LumenalUniRule annotation1 PublicationAdd BLAST12
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei13 – 33HelicalUniRule annotation1 PublicationAdd BLAST21
Topological domaini34 – 45LumenalUniRule annotation1 Publication1 PublicationAdd BLAST12
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei46 – 66HelicalUniRule annotationAdd BLAST21
Topological domaini67 – 93CytoplasmicUniRule annotation1 PublicationAdd BLAST27
Transmembranei94 – 114HelicalUniRule annotationAdd BLAST21
Topological domaini115 – 157LumenalUniRule annotation1 Publication1 PublicationAdd BLAST43
Transmembranei158 – 178HelicalUniRule annotationAdd BLAST21
Topological domaini179 – 199CytoplasmicUniRule annotation1 Publication1 PublicationAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi98G → E: Impairs binding to S-adenosyl-L-methionine. 1 Publication1
Mutagenesisi100G → D: Abolishes binding to S-adenosyl-L-methionine. 1 Publication1
Mutagenesisi180E → D: Abolishes binding to S-adenosyl-L-methionine. 1 Publication1
Mutagenesisi181E → D: Impairs binding to S-adenosyl-L-methionine. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		10400

Open Targets

More...OpenTargetsi		ENSG00000133027

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33175

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UBM1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PEMT

Domain mapping of disease mutations (DMDM)

More...DMDMi		148887406

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001939201 – 199Phosphatidylethanolamine N-methyltransferaseAdd BLAST199

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 2 is N-glycosylated with high-mannose oligosaccharides.1 Publication

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UBM1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UBM1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UBM1

PeptideAtlas

More...PeptideAtlasi		Q9UBM1

PRoteomics IDEntifications database

More...PRIDEi		Q9UBM1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		2457
84006 [Q9UBM1-1]
84007 [Q9UBM1-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9UBM1-1 [Q9UBM1-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UBM1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000133027 Expressed in 190 organ(s), highest expression level in corpus epididymis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UBM1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UBM1 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA042375

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		115672, 1 interactor

Protein interaction database and analysis system

More...IntActi		Q9UBM1, 2 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000255389

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni98 – 100S-adenosyl-L-methionine bindingUniRule annotation1 Publication3
Regioni180 – 181S-adenosyl-L-methionine bindingUniRule annotation1 Publication2

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class VI-like SAM-binding methyltransferase superfamily. PEMT/PEM2 methyltransferase family.UniRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4142 Eukaryota
ENOG4111HY0 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000007041

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000208789

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UBM1

KEGG Orthology (KO)

More...KOi		K00551

Identification of Orthologs from Complete Genome Data

More...OMAi		FNPTFWN

Database of Orthologous Groups

More...OrthoDBi		1395721at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UBM1

TreeFam database of animal gene trees

More...TreeFami		TF300198

Family and domain databases

HAMAP database of protein families

More...HAMAPi		MF_03216 PLMT, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR024960 PEMT/MFAP
IPR007318 Phopholipid_MeTrfase

The PANTHER Classification System

More...PANTHERi		PTHR15458 PTHR15458, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04191 PEMT, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF005444 PEMT, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51599 SAM_PEMT_PEM2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBM1-1) [UniParc]FASTAAdd to basket
Also known as: PEMT-S

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTRLLGYVDP LDPSFVAAVI TITFNPLYWN VVARWEHKTR KLSRAFGSPY 
        60         70         80         90        100
LACYSLSVTI LLLNFLRSHC FTQAMLSQPR MESLDTPAAY SLGLALLGLG 
       110        120        130        140        150
VVLVLSSFFA LGFAGTFLGD YFGILKEARV TVFPFNILDN PMYWGSTANY 
       160        170        180        190 
LGWAIMHASP TGLLLTVLVA LTYIVALLYE EPFTAEIYRQ KASGSHKRS
Length:199
Mass (Da):22,134
Last modified:June 12, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i98C07AB54B3B4E6A
GO
Isoform 2 (identifier: Q9UBM1-2) [UniParc]FASTAAdd to basket
Also known as: PEMT-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKRSGNPGAEVTNSSVAGPDCCGGLGNIDFRQADFCVM

Note: Much lower enzymatic activity than isoform 1.1 Publication
Show »
Length:236
Mass (Da):25,890
Checksum:i024AEDF227E93FEE
GO
Isoform 3 (identifier: Q9UBM1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKRSGNPGAEVTNSSVAGPDCCGGLGNIDFRQADFCVM
     156-199: MHASPTGLLL...QKASGSHKRS → IPAPAGAVGS...GSPIRRALHR

Note: No experimental confirmation available.Curated
Show »
Length:232
Mass (Da):24,967
Checksum:iACB01FB93D481894
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YTC7D3YTC7_HUMAN
Phosphatidylethanolamine N-methyltr...
PEMT
211Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTR2J3KTR2_HUMAN
Phosphatidylethanolamine N-methyltr...
PEMT
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLU8J3QLU8_HUMAN
Phosphatidylethanolamine N-methyltr...
PEMT
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF14867 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 3 (identifier: Q9UBM1-3)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti222S → N in BAG63603 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0553723R → W. Corresponds to variant dbSNP:rs70959686Ensembl.1
Natural variantiVAR_03277158V → I4 PublicationsCorresponds to variant dbSNP:rs897453Ensembl.1
Natural variantiVAR_06008358V → L. Corresponds to variant dbSNP:rs897453Ensembl.1
Natural variantiVAR_016093175V → M6 PublicationsCorresponds to variant dbSNP:rs7946Ensembl.1
Natural variantiVAR_055373194G → R. Corresponds to variant dbSNP:rs70965427Ensembl.1
Isoform 2 (identifier: Q9UBM1-2)
Natural varianti11V → A1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0373111M → MKRSGNPGAEVTNSSVAGPD CCGGLGNIDFRQADFCVM in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_046034156 – 199MHASP…SHKRS → IPAPAGAVGSEARQPHGPAP DGAGGPHLHSGSPIRRALHR in isoform 3. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF176807 mRNA Translation: AAD53292.1
AF176806 mRNA Translation: AAD53291.1
AF294468
, AF294463, AF294464, AF294465, AF294466, AF294467 Genomic DNA Translation: AAK19172.1
AB029821 mRNA Translation: BAA82407.1
AF113126 mRNA Translation: AAF14867.1 Different initiation.
AK302251 mRNA Translation: BAG63603.1
CR457099 mRNA Translation: CAG33380.1
EU574003 Genomic DNA Translation: ACB21050.1
AC020558 Genomic DNA No translation available.
CH471196 Genomic DNA Translation: EAW55701.1
CH471196 Genomic DNA Translation: EAW55702.1
BC000557 mRNA Translation: AAH00557.1
BC050593 mRNA Translation: AAH50593.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11186.1 [Q9UBM1-2]
CCDS11187.1 [Q9UBM1-1]
CCDS58520.1 [Q9UBM1-3]

NCBI Reference Sequences

More...RefSeqi		NP_001254480.1, NM_001267551.1
NP_001254481.1, NM_001267552.1 [Q9UBM1-3]
NP_009100.2, NM_007169.2 [Q9UBM1-1]
NP_680477.1, NM_148172.2 [Q9UBM1-2]
NP_680478.1, NM_148173.1 [Q9UBM1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000255389; ENSP00000255389; ENSG00000133027 [Q9UBM1-2]
ENST00000395781; ENSP00000379127; ENSG00000133027 [Q9UBM1-3]
ENST00000395782; ENSP00000379128; ENSG00000133027 [Q9UBM1-1]
ENST00000395783; ENSP00000379129; ENSG00000133027 [Q9UBM1-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10400

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10400

UCSC genome browser

More...UCSCi		uc002grj.3 human [Q9UBM1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176807 mRNA Translation: AAD53292.1
AF176806 mRNA Translation: AAD53291.1
AF294468
, AF294463, AF294464, AF294465, AF294466, AF294467 Genomic DNA Translation: AAK19172.1
AB029821 mRNA Translation: BAA82407.1
AF113126 mRNA Translation: AAF14867.1 Different initiation.
AK302251 mRNA Translation: BAG63603.1
CR457099 mRNA Translation: CAG33380.1
EU574003 Genomic DNA Translation: ACB21050.1
AC020558 Genomic DNA No translation available.
CH471196 Genomic DNA Translation: EAW55701.1
CH471196 Genomic DNA Translation: EAW55702.1
BC000557 mRNA Translation: AAH00557.1
BC050593 mRNA Translation: AAH50593.1
CCDSiCCDS11186.1 [Q9UBM1-2]
CCDS11187.1 [Q9UBM1-1]
CCDS58520.1 [Q9UBM1-3]
RefSeqiNP_001254480.1, NM_001267551.1
NP_001254481.1, NM_001267552.1 [Q9UBM1-3]
NP_009100.2, NM_007169.2 [Q9UBM1-1]
NP_680477.1, NM_148172.2 [Q9UBM1-2]
NP_680478.1, NM_148173.1 [Q9UBM1-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi115672, 1 interactor
IntActiQ9UBM1, 2 interactors
STRINGi9606.ENSP00000255389

Chemistry databases

SwissLipidsiSLP:000001199 [Q9UBM1-1]

PTM databases

iPTMnetiQ9UBM1

Polymorphism and mutation databases

BioMutaiPEMT
DMDMi148887406

Proteomic databases

jPOSTiQ9UBM1
MassIVEiQ9UBM1
PaxDbiQ9UBM1
PeptideAtlasiQ9UBM1
PRIDEiQ9UBM1
ProteomicsDBi2457
84006 [Q9UBM1-1]
84007 [Q9UBM1-2]
TopDownProteomicsiQ9UBM1-1 [Q9UBM1-1]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		10400

Genome annotation databases

EnsembliENST00000255389; ENSP00000255389; ENSG00000133027 [Q9UBM1-2]
ENST00000395781; ENSP00000379127; ENSG00000133027 [Q9UBM1-3]
ENST00000395782; ENSP00000379128; ENSG00000133027 [Q9UBM1-1]
ENST00000395783; ENSP00000379129; ENSG00000133027 [Q9UBM1-1]
GeneIDi10400
KEGGihsa:10400
UCSCiuc002grj.3 human [Q9UBM1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10400
DisGeNETi10400

GeneCards: human genes, protein and diseases

More...GeneCardsi		PEMT
HGNCiHGNC:8830 PEMT
HPAiHPA042375
MIMi602391 gene
neXtProtiNX_Q9UBM1
OpenTargetsiENSG00000133027
PharmGKBiPA33175

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4142 Eukaryota
ENOG4111HY0 LUCA
GeneTreeiENSGT00390000007041
HOGENOMiHOG000208789
InParanoidiQ9UBM1
KOiK00551
OMAiFNPTFWN
OrthoDBi1395721at2759
PhylomeDBiQ9UBM1
TreeFamiTF300198

Enzyme and pathway databases

UniPathwayiUPA00753
BRENDAi2.1.1.17 2681
ReactomeiR-HSA-1483191 Synthesis of PC

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PEMT human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Phosphatidyl_ethanolamine_methyltransferase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10400
PharosiQ9UBM1

Protein Ontology

More...PROi		PR:Q9UBM1

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000133027 Expressed in 190 organ(s), highest expression level in corpus epididymis
ExpressionAtlasiQ9UBM1 baseline and differential
GenevisibleiQ9UBM1 HS

Family and domain databases

HAMAPiMF_03216 PLMT, 1 hit
InterProiView protein in InterPro
IPR024960 PEMT/MFAP
IPR007318 Phopholipid_MeTrfase
PANTHERiPTHR15458 PTHR15458, 1 hit
PfamiView protein in Pfam
PF04191 PEMT, 1 hit
PIRSFiPIRSF005444 PEMT, 1 hit
PROSITEiView protein in PROSITE
PS51599 SAM_PEMT_PEM2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPEMT_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBM1
Secondary accession number(s): A8MZ66
, B4DY41, D3DXC3, Q6IAQ5, Q86VL3, Q9BW86, Q9UHY6, Q9Y6V9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: June 12, 2007
Last modified: October 16, 2019
This is version 159 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again