Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UBL0 (ARP21_HUMAN)

Entry version 140 (07 Apr 2021)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Add a publicationFeedback
Protein

cAMP-regulated phosphoprotein 21

Gene

ARPP21

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 2 may act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UBL0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cAMP-regulated phosphoprotein 21
Short name:
ARPP-21
Alternative name(s):
Thymocyte cAMP-regulated phosphoprotein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARPP21
Synonyms:TARPP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:16968, ARPP21

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605488, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UBL0

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000172995.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		10777

Open Targets

More...OpenTargetsi		ENSG00000172995

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UBL0, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ARPP21

Domain mapping of disease mutations (DMDM)

More...DMDMi		160332340

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000646822 – 812cAMP-regulated phosphoprotein 21Add BLAST811

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei33PhosphoserineCombined sources1
Modified residuei56PhosphoserineBy similarity1
Modified residuei134PhosphoserineBy similarity1
Modified residuei300PhosphoserineBy similarity1
Modified residuei363PhosphoserineBy similarity1
Modified residuei383PhosphoserineCombined sources1
Modified residuei562PhosphoserineCombined sources1
Modified residuei655Asymmetric dimethylarginine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-56 favors interaction with CALM1.By similarity
Isoform 1 is methylated by CARM1 at Arg-655 in immature thymocytes.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UBL0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UBL0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9UBL0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UBL0

PeptideAtlas

More...PeptideAtlasi		Q9UBL0

PRoteomics IDEntifications database

More...PRIDEi		Q9UBL0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83988 [Q9UBL0-1]
83989 [Q9UBL0-2]
83990 [Q9UBL0-3]
83991 [Q9UBL0-4]
83992 [Q9UBL0-5]
83993 [Q9UBL0-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UBL0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UBL0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is expressed in brain. Isoform 1 is present in immature thymocytes (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000172995, Expressed in caudate nucleus and 153 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UBL0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UBL0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000172995, Group enriched (brain, lymphoid tissue, skeletal muscle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CALM1.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115995, 3 interactors

Protein interaction database and analysis system

More...IntActi		Q9UBL0, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000412326

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UBL0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UBL0

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini164 – 227R3HPROSITE-ProRule annotationAdd BLAST64
Domaini228 – 300SUZPROSITE-ProRule annotationAdd BLAST73

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili32 – 58Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi338 – 423Ser-richAdd BLAST86
Compositional biasi506 – 754Gln-richAdd BLAST249

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2953, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160796

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_2256194_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UBL0

Identification of Orthologs from Complete Genome Data

More...OMAi		ANCRTNC

Database of Orthologous Groups

More...OrthoDBi		137913at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UBL0

TreeFam database of animal gene trees

More...TreeFami		TF315915

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1370.50, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001374, R3H_dom
IPR036867, R3H_dom_sf
IPR024771, SUZ

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01424, R3H, 1 hit
PF12752, SUZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00393, R3H, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF82708, SSF82708, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51061, R3H, 1 hit
PS51673, SUZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBL0-1) [UniParc]FASTAAdd to basket
Also known as: TARPP

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEQGDLNQA IAEEGGTEQE TATPENGIVK SESLDEEEKL ELQRRLEAQN 
        60         70         80         90        100
QERRKSKSGA GKGKLTRSLA VCEESSARPG GESLQDQESI HLQLSSFSSL 
       110        120        130        140        150
QEEDKSRKDD SEREKEKDKN KDKTSEKPKI RMLSKDCSQE YTDSTGIDLH 
       160        170        180        190        200
EFLINTLKNN SRDRMILLKM EQEIIDFIAD NNNHYKKFPQ MSSYQRMLVH 
       210        220        230        240        250
RVAAYFGLDH NVDQTGKSVI INKTSSTRIP EQRFCEHLKD EKGEESQKRF 
       260        270        280        290        300
ILKRDNSSID KEDNQQNRMH PFRDDRRSKS IEEREEEYQR VRERIFAHDS 
       310        320        330        340        350
VCSQESLFVE NSRLLEDSNI CNETYKKRQL FRGNRDGSGR TSGSRQSSSE 
       360        370        380        390        400
NELKWSDHQR AWSSTDSDSS NRNLKPAMTK TASFGGITVL TRGDSTSSTR 
       410        420        430        440        450
STGKLSKAGS ESSSSAGSSG SLSRTHPPLQ STPLVSGVAA GSPGCVPYPE 
       460        470        480        490        500
NGIGGQVAPS STSYILLPLE AATGIPPGSI LLNPHTGQPF VNPDGTPAIY 
       510        520        530        540        550
NPPTSQQPLR SAMVGQSQQQ PPQQQPSPQP QQQVQPPQPQ MAGPLVTQRD 
       560        570        580        590        600
DVATQFGQMT LSRQSSGETP EPPSGPVYPS SLMPQPAQQP SYVIASTGQQ 
       610        620        630        640        650
LPTGGFSGSG PPISQQVLQP PPSPQGFVQQ PPPAQMPVYY YPSGQYPTST 
       660        670        680        690        700
TQQYRPMAPV QYNAQRSQQM PQAAQQAGYQ PVLSGQQGFQ GLIGVQQPPQ 
       710        720        730        740        750
SQNVINNQQG TPVQSVMVSY PTMSSYQVPM TQGSQGLPQQ SYQQPIMLPN 
       760        770        780        790        800
QAGQGSLPAT GMPVYCNVTP PTPQNNLRLI GPHCPSSTVP VMSASCRTNC 
       810 
ASMSNAGWQV KF
Length:812
Mass (Da):89,196
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i73981A8341BB3359
GO
Isoform 2 (identifier: Q9UBL0-2) [UniParc]FASTAAdd to basket
Also known as: ARPP-21

The sequence of this isoform differs from the canonical sequence as follows:
     88-89: ES → TL
     90-812: Missing.

Show »
Length:89
Mass (Da):9,674
Checksum:i94654817C61B4C94
GO
Isoform 3 (identifier: Q9UBL0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-299: Missing.
     548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM

Show »
Length:813
Mass (Da):88,570
Checksum:i1F6E07737C11CC45
GO
Isoform 4 (identifier: Q9UBL0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-299: Missing.
     312-331: Missing.
     548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM

Show »
Length:793
Mass (Da):86,131
Checksum:iF523AEF3E39114BE
GO
Isoform 5 (identifier: Q9UBL0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-512: Missing.
     548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM

Show »
Length:335
Mass (Da):35,931
Checksum:i3AF26F827EDD5066
GO
Isoform 6 (identifier: Q9UBL0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-108: ESIHLQLSSFSSLQEEDKSRK → VYPLAIIINCMNGIHLCVHDS
     109-812: Missing.

Show »
Length:108
Mass (Da):11,768
Checksum:i2AABF43866F7CCE8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C2X8H7C2X8_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
261Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JD93C9JD93_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JQQ6C9JQQ6_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J091C9J091_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J5R1C9J5R1_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JI74C9JI74_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTF2C9JTF2_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTX6C9JTX6_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDL2F8WDL2_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3J7H7C3J7_HUMAN
cAMP-regulated phosphoprotein 21
ARPP21
241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti312Missing in CAB61414 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0294691 – 512Missing in isoform 5. 1 PublicationAdd BLAST512
Alternative sequenceiVSP_02947088 – 108ESIHL…DKSRK → VYPLAIIINCMNGIHLCVHD S in isoform 6. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_02947188 – 89ES → TL in isoform 2. 3 Publications2
Alternative sequenceiVSP_02947290 – 812Missing in isoform 2. 3 PublicationsAdd BLAST723
Alternative sequenceiVSP_029473109 – 812Missing in isoform 6. 1 PublicationAdd BLAST704
Alternative sequenceiVSP_029474266 – 299Missing in isoform 3 and isoform 4. 3 PublicationsAdd BLAST34
Alternative sequenceiVSP_029475312 – 331Missing in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_029476548Q → QSVQGLQASSQSVQYPAVSF PPQHLLPVSPTQHFPM in isoform 3, isoform 4 and isoform 5. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF112220 mRNA Translation: AAF17207.1
AK294484 mRNA Translation: BAG57707.1
CH471055 Genomic DNA Translation: EAW64471.1
BC017805 mRNA Translation: AAH17805.1
BC031106 mRNA Translation: AAH31106.1
BC036399 mRNA Translation: AAH36399.1
BC041385 mRNA Translation: AAH41385.1
BC051828 mRNA Translation: AAH51828.1
BC066651 mRNA Translation: AAH66651.1
AL133109 mRNA Translation: CAB61414.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2661.1 [Q9UBL0-1]
CCDS43063.1 [Q9UBL0-2]
CCDS58823.1 [Q9UBL0-3]
CCDS58824.1 [Q9UBL0-4]

Protein sequence database of the Protein Information Resource

More...PIRi		T42644

NCBI Reference Sequences

More...RefSeqi		NP_001020239.1, NM_001025068.1 [Q9UBL0-2]
NP_001020240.1, NM_001025069.1 [Q9UBL0-2]
NP_001254545.1, NM_001267616.1 [Q9UBL0-2]
NP_001254546.1, NM_001267617.1 [Q9UBL0-4]
NP_001254547.1, NM_001267618.1 [Q9UBL0-2]
NP_001254548.1, NM_001267619.1 [Q9UBL0-3]
NP_057384.2, NM_016300.4 [Q9UBL0-1]
NP_938409.1, NM_198399.1 [Q9UBL0-2]
XP_006713006.1, XM_006712943.2 [Q9UBL0-3]
XP_006713007.1, XM_006712944.2 [Q9UBL0-4]
XP_016861081.1, XM_017005592.1 [Q9UBL0-3]
XP_016861082.1, XM_017005593.1 [Q9UBL0-3]
XP_016861083.1, XM_017005594.1 [Q9UBL0-3]
XP_016861084.1, XM_017005595.1 [Q9UBL0-3]
XP_016861091.1, XM_017005602.1 [Q9UBL0-4]
XP_016861092.1, XM_017005603.1 [Q9UBL0-4]
XP_016861093.1, XM_017005604.1 [Q9UBL0-4]
XP_016861094.1, XM_017005605.1 [Q9UBL0-4]
XP_016861095.1, XM_017005606.1 [Q9UBL0-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000187397; ENSP00000187397; ENSG00000172995 [Q9UBL0-1]
ENST00000396481; ENSP00000379741; ENSG00000172995 [Q9UBL0-2]
ENST00000396482; ENSP00000379742; ENSG00000172995 [Q9UBL0-2]
ENST00000412048; ENSP00000390151; ENSG00000172995 [Q9UBL0-2]
ENST00000417925; ENSP00000412326; ENSG00000172995 [Q9UBL0-3]
ENST00000427542; ENSP00000401602; ENSG00000172995 [Q9UBL0-2]
ENST00000428373; ENSP00000412411; ENSG00000172995 [Q9UBL0-2]
ENST00000432682; ENSP00000389754; ENSG00000172995 [Q9UBL0-2]
ENST00000436702; ENSP00000397720; ENSG00000172995 [Q9UBL0-2]
ENST00000438071; ENSP00000410171; ENSG00000172995 [Q9UBL0-2]
ENST00000441454; ENSP00000406964; ENSG00000172995 [Q9UBL0-2]
ENST00000444190; ENSP00000405276; ENSG00000172995 [Q9UBL0-4]
ENST00000474696; ENSP00000417838; ENSG00000172995 [Q9UBL0-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10777

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10777

UCSC genome browser

More...UCSCi		uc003cfz.5, human [Q9UBL0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF112220 mRNA Translation: AAF17207.1
AK294484 mRNA Translation: BAG57707.1
CH471055 Genomic DNA Translation: EAW64471.1
BC017805 mRNA Translation: AAH17805.1
BC031106 mRNA Translation: AAH31106.1
BC036399 mRNA Translation: AAH36399.1
BC041385 mRNA Translation: AAH41385.1
BC051828 mRNA Translation: AAH51828.1
BC066651 mRNA Translation: AAH66651.1
AL133109 mRNA Translation: CAB61414.1
CCDSiCCDS2661.1 [Q9UBL0-1]
CCDS43063.1 [Q9UBL0-2]
CCDS58823.1 [Q9UBL0-3]
CCDS58824.1 [Q9UBL0-4]
PIRiT42644
RefSeqiNP_001020239.1, NM_001025068.1 [Q9UBL0-2]
NP_001020240.1, NM_001025069.1 [Q9UBL0-2]
NP_001254545.1, NM_001267616.1 [Q9UBL0-2]
NP_001254546.1, NM_001267617.1 [Q9UBL0-4]
NP_001254547.1, NM_001267618.1 [Q9UBL0-2]
NP_001254548.1, NM_001267619.1 [Q9UBL0-3]
NP_057384.2, NM_016300.4 [Q9UBL0-1]
NP_938409.1, NM_198399.1 [Q9UBL0-2]
XP_006713006.1, XM_006712943.2 [Q9UBL0-3]
XP_006713007.1, XM_006712944.2 [Q9UBL0-4]
XP_016861081.1, XM_017005592.1 [Q9UBL0-3]
XP_016861082.1, XM_017005593.1 [Q9UBL0-3]
XP_016861083.1, XM_017005594.1 [Q9UBL0-3]
XP_016861084.1, XM_017005595.1 [Q9UBL0-3]
XP_016861091.1, XM_017005602.1 [Q9UBL0-4]
XP_016861092.1, XM_017005603.1 [Q9UBL0-4]
XP_016861093.1, XM_017005604.1 [Q9UBL0-4]
XP_016861094.1, XM_017005605.1 [Q9UBL0-4]
XP_016861095.1, XM_017005606.1 [Q9UBL0-4]

3D structure databases

SMRiQ9UBL0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi115995, 3 interactors
IntActiQ9UBL0, 3 interactors
STRINGi9606.ENSP00000412326

PTM databases

iPTMnetiQ9UBL0
PhosphoSitePlusiQ9UBL0

Genetic variation databases

BioMutaiARPP21
DMDMi160332340

Proteomic databases

jPOSTiQ9UBL0
MassIVEiQ9UBL0
MaxQBiQ9UBL0
PaxDbiQ9UBL0
PeptideAtlasiQ9UBL0
PRIDEiQ9UBL0
ProteomicsDBi83988 [Q9UBL0-1]
83989 [Q9UBL0-2]
83990 [Q9UBL0-3]
83991 [Q9UBL0-4]
83992 [Q9UBL0-5]
83993 [Q9UBL0-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2806, 158 antibodies

The DNASU plasmid repository

More...DNASUi		10777

Genome annotation databases

EnsembliENST00000187397; ENSP00000187397; ENSG00000172995 [Q9UBL0-1]
ENST00000396481; ENSP00000379741; ENSG00000172995 [Q9UBL0-2]
ENST00000396482; ENSP00000379742; ENSG00000172995 [Q9UBL0-2]
ENST00000412048; ENSP00000390151; ENSG00000172995 [Q9UBL0-2]
ENST00000417925; ENSP00000412326; ENSG00000172995 [Q9UBL0-3]
ENST00000427542; ENSP00000401602; ENSG00000172995 [Q9UBL0-2]
ENST00000428373; ENSP00000412411; ENSG00000172995 [Q9UBL0-2]
ENST00000432682; ENSP00000389754; ENSG00000172995 [Q9UBL0-2]
ENST00000436702; ENSP00000397720; ENSG00000172995 [Q9UBL0-2]
ENST00000438071; ENSP00000410171; ENSG00000172995 [Q9UBL0-2]
ENST00000441454; ENSP00000406964; ENSG00000172995 [Q9UBL0-2]
ENST00000444190; ENSP00000405276; ENSG00000172995 [Q9UBL0-4]
ENST00000474696; ENSP00000417838; ENSG00000172995 [Q9UBL0-2]
GeneIDi10777
KEGGihsa:10777
UCSCiuc003cfz.5, human [Q9UBL0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10777
DisGeNETi10777

GeneCards: human genes, protein and diseases

More...GeneCardsi		ARPP21
HGNCiHGNC:16968, ARPP21
HPAiENSG00000172995, Group enriched (brain, lymphoid tissue, skeletal muscle)
MIMi605488, gene
neXtProtiNX_Q9UBL0
OpenTargetsiENSG00000172995
VEuPathDBiHostDB:ENSG00000172995.16

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2953, Eukaryota
GeneTreeiENSGT00940000160796
HOGENOMiCLU_2256194_0_0_1
InParanoidiQ9UBL0
OMAiANCRTNC
OrthoDBi137913at2759
PhylomeDBiQ9UBL0
TreeFamiTF315915

Enzyme and pathway databases

PathwayCommonsiQ9UBL0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10777, 5 hits in 977 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ARPP21, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ARPP-21

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10777
PharosiQ9UBL0, Tbio

Protein Ontology

More...PROi		PR:Q9UBL0
RNActiQ9UBL0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000172995, Expressed in caudate nucleus and 153 other tissues
ExpressionAtlasiQ9UBL0, baseline and differential
GenevisibleiQ9UBL0, HS

Family and domain databases

Gene3Di3.30.1370.50, 1 hit
InterProiView protein in InterPro
IPR001374, R3H_dom
IPR036867, R3H_dom_sf
IPR024771, SUZ
PfamiView protein in Pfam
PF01424, R3H, 1 hit
PF12752, SUZ, 1 hit
SMARTiView protein in SMART
SM00393, R3H, 1 hit
SUPFAMiSSF82708, SSF82708, 1 hit
PROSITEiView protein in PROSITE
PS51061, R3H, 1 hit
PS51673, SUZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARP21_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBL0
Secondary accession number(s): B4DG96
, Q49AK3, Q49AS6, Q4G0V4, Q6NYC3, Q86V31, Q9UF93
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: November 13, 2007
Last modified: April 7, 2021
This is version 140 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again