Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UBI4 (STML1_HUMAN)

Entry version 150 (02 Dec 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Stomatin-like protein 1

Gene

STOML1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in cholesterol transfer to late endosomes (PubMed:19696025). May play a role in modulating membrane acid-sensing ion channels. Can specifically inhibit proton-gated current of ASIC1 isoform 1. Can increase inactivation speed of ASIC3. May be involved in regulation of proton sensing in dorsal root ganglions (By similarity). May play a role in protecting FBXW7 isoform 3 from degradation (PubMed:23082202).By similarity1 Publication1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processLipid transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9UBI4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Stomatin-like protein 1
Short name:
SLP-1
Alternative name(s):
EPB72-like protein 1
Protein unc-24 homolog
Stomatin-related protein
Short name:
STORP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STOML1
Synonyms:SLP1, UNC24
ORF Names:MSTP019
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000067221.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:14560, STOML1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608326, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UBI4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei58 – 78Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini79 – 398CytoplasmicSequence analysisAdd BLAST320

Keywords - Cellular componenti

Cell membrane, Cytoplasmic vesicle, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi7Y → A: Plasma membrane localization. 1 Publication1
Mutagenesisi10L → S: Plasma membrane localization. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		9399

Open Targets

More...OpenTargetsi		ENSG00000067221

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37898

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9UBI4, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		STOML1

Domain mapping of disease mutations (DMDM)

More...DMDMi		60415942

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000940291 – 398Stomatin-like protein 1Add BLAST398

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei28PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UBI4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9UBI4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9UBI4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UBI4

PeptideAtlas

More...PeptideAtlasi		Q9UBI4

PRoteomics IDEntifications database

More...PRIDEi		Q9UBI4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		17957
42124
5218
83973 [Q9UBI4-1]
83974 [Q9UBI4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UBI4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UBI4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed at low levels. Expression is highest in brain.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000067221, Expressed in tendon of biceps brachii and 234 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UBI4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UBI4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000067221, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with STOM; may redistribute STOM from the plasma membrane to late endosomes (PubMed:19696025).

Interacts with FBXW7 isoform 3 and CDK2 (PubMed:23082202).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114796, 6 interactors

Protein interaction database and analysis system

More...IntActi		Q9UBI4, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000442478

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9UBI4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UBI4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini287 – 398SCP2Add BLAST112

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi6 – 10Tyrosine-type lysosomal sorting signalSequence analysis1 Publication5

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the band 7/mec-2 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2621, Eukaryota
KOG4170, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01010000222507

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_049498_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UBI4

Identification of Orthologs from Complete Genome Data

More...OMAi		SFDYIPN

Database of Orthologous Groups

More...OrthoDBi		1062075at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UBI4

TreeFam database of animal gene trees

More...TreeFami		TF105750

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1050.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR043202, Band-7_stomatin-like
IPR001107, Band_7
IPR036013, Band_7/SPFH_dom_sf
IPR003033, SCP2_sterol-bd_dom
IPR036527, SCP2_sterol-bd_dom_sf
IPR001972, Stomatin_HflK_HflKC_fam

The PANTHER Classification System

More...PANTHERi		PTHR10264, PTHR10264, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01145, Band_7, 1 hit
PF02036, SCP2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00721, STOMATIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00244, PHB, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF117892, SSF117892, 1 hit
SSF55718, SSF55718, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBI4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGRSGYRAL PLGDFDRFQQ SSFGFLGSQK GCLSPERGGV GTGADVPQSW 
        60         70         80         90        100
PSCLCHGLIS FLGFLLLLVT FPISGWFALK IVPTYERMIV FRLGRIRTPQ 
       110        120        130        140        150
GPGMVLLLPF IDSFQRVDLR TRAFNVPPCK LASKDGAVLS VGADVQFRIW 
       160        170        180        190        200
DPVLSVMTVK DLNTATRMTA QNAMTKALLK RPLREIQMEK LKISDQLLLE 
       210        220        230        240        250
INDVTRAWGL EVDRVELAVE AVLQPPQDSP AGPNLDSTLQ QLALHFLGGS 
       260        270        280        290        300
MNSMAGGAPS PGPADTVEMV SEVEPPAPQV GARSSPKQPL AEGLLTALQP 
       310        320        330        340        350
FLSEALVSQV GACYQFNVVL PSGTQSAYFL DLTTGRGRVG HGVPDGIPDV 
       360        370        380        390 
VVEMAEADLR ALLCRELRPL GAYMSGRLKV KGDLAMAMKL EAVLRALK
Length:398
Mass (Da):42,968
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA9850C26394E1C3D
GO
Isoform 2 (identifier: Q9UBI4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-129: Missing.

Show »
Length:348
Mass (Da):37,170
Checksum:i436B02A898059006
GO
Isoform 3 (identifier: Q9UBI4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     264-264: Missing.

Show »
Length:397
Mass (Da):42,897
Checksum:iD88DFC8B3AB37397
GO
Isoform 4 (identifier: Q9UBI4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-129: Missing.
     264-264: Missing.

Show »
Length:347
Mass (Da):37,099
Checksum:i2683722A713F4830
GO
Isoform 5 (identifier: Q9UBI4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGA → MP
     264-264: Missing.

Show »
Length:355
Mass (Da):38,534
Checksum:i59AB1BE8E1A34A9A
GO
Isoform 6 (identifier: Q9UBI4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     264-264: Missing.
     265-334: Missing.

Show »
Length:327
Mass (Da):35,520
Checksum:i7910E73D608CEED9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BQA9H3BQA9_HUMAN
Stomatin-like protein 1
STOML1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BST3H3BST3_HUMAN
Stomatin-like protein 1
STOML1
310Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPC1H3BPC1_HUMAN
Stomatin-like protein 1
STOML1
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BVF2H3BVF2_HUMAN
Stomatin-like protein 1
STOML1
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD42031 differs from that shown. Reason: Frameshift.Curated
The sequence CAA76271 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti50W → G in CAG46886 (Ref. 5) Curated1
Sequence conflicti222V → L in AAL39002 (Ref. 3) Curated1
Sequence conflicti291A → T in CAG46886 (Ref. 5) Curated1
Sequence conflicti369P → R in CAA76271 (PubMed:9931417).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0546481 – 44MLGRS…VGTGA → MP in isoform 5. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_01265480 – 129Missing in isoform 2 and isoform 4. 3 PublicationsAdd BLAST50
Alternative sequenceiVSP_054649264Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 4 Publications1
Alternative sequenceiVSP_054650265 – 334Missing in isoform 6. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y16522 mRNA Translation: CAA76271.1 Frameshift.
AF156564 AF156561 Genomic DNA Translation: AAF23080.1
AF156557 mRNA Translation: AAF06960.1
AF111800 mRNA Translation: AAL39002.1
DQ064605 mRNA Translation: AAY68393.1
CR542089 mRNA Translation: CAG46886.1
AK300799 mRNA Translation: BAG62457.1
AK302051 mRNA Translation: BAG63441.1
AK075244 mRNA Translation: BAG52092.1
AC108137 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77940.1
CH471082 Genomic DNA Translation: EAW77944.1
BC034379 mRNA Translation: AAH34379.1
BC065249 mRNA Translation: AAH65249.1
AF074953 mRNA Translation: AAD42031.1 Frameshift.
AL109664 mRNA Translation: CAB52015.1
AL109665 mRNA Translation: CAB52016.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10254.1 [Q9UBI4-1]
CCDS58382.1 [Q9UBI4-5]
CCDS58383.1 [Q9UBI4-4]
CCDS58384.1 [Q9UBI4-2]
CCDS58385.1 [Q9UBI4-6]

NCBI Reference Sequences

More...RefSeqi		NP_001243601.1, NM_001256672.1 [Q9UBI4-3]
NP_001243602.1, NM_001256673.1 [Q9UBI4-2]
NP_001243603.1, NM_001256674.1 [Q9UBI4-4]
NP_001243604.1, NM_001256675.1 [Q9UBI4-6]
NP_001243605.1, NM_001256676.1
NP_001243606.1, NM_001256677.1 [Q9UBI4-5]
NP_004800.2, NM_004809.4 [Q9UBI4-1]
XP_006720836.1, XM_006720773.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000316900; ENSP00000319323; ENSG00000067221 [Q9UBI4-5]
ENST00000316911; ENSP00000319384; ENSG00000067221 [Q9UBI4-2]
ENST00000359750; ENSP00000352788; ENSG00000067221 [Q9UBI4-6]
ENST00000541638; ENSP00000442478; ENSG00000067221 [Q9UBI4-1]
ENST00000564777; ENSP00000456343; ENSG00000067221 [Q9UBI4-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9399

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9399

UCSC genome browser

More...UCSCi		uc002awe.5, human [Q9UBI4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16522 mRNA Translation: CAA76271.1 Frameshift.
AF156564 AF156561 Genomic DNA Translation: AAF23080.1
AF156557 mRNA Translation: AAF06960.1
AF111800 mRNA Translation: AAL39002.1
DQ064605 mRNA Translation: AAY68393.1
CR542089 mRNA Translation: CAG46886.1
AK300799 mRNA Translation: BAG62457.1
AK302051 mRNA Translation: BAG63441.1
AK075244 mRNA Translation: BAG52092.1
AC108137 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77940.1
CH471082 Genomic DNA Translation: EAW77944.1
BC034379 mRNA Translation: AAH34379.1
BC065249 mRNA Translation: AAH65249.1
AF074953 mRNA Translation: AAD42031.1 Frameshift.
AL109664 mRNA Translation: CAB52015.1
AL109665 mRNA Translation: CAB52016.1
CCDSiCCDS10254.1 [Q9UBI4-1]
CCDS58382.1 [Q9UBI4-5]
CCDS58383.1 [Q9UBI4-4]
CCDS58384.1 [Q9UBI4-2]
CCDS58385.1 [Q9UBI4-6]
RefSeqiNP_001243601.1, NM_001256672.1 [Q9UBI4-3]
NP_001243602.1, NM_001256673.1 [Q9UBI4-2]
NP_001243603.1, NM_001256674.1 [Q9UBI4-4]
NP_001243604.1, NM_001256675.1 [Q9UBI4-6]
NP_001243605.1, NM_001256676.1
NP_001243606.1, NM_001256677.1 [Q9UBI4-5]
NP_004800.2, NM_004809.4 [Q9UBI4-1]
XP_006720836.1, XM_006720773.3

3D structure databases

SMRiQ9UBI4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114796, 6 interactors
IntActiQ9UBI4, 5 interactors
STRINGi9606.ENSP00000442478

PTM databases

iPTMnetiQ9UBI4
PhosphoSitePlusiQ9UBI4

Polymorphism and mutation databases

BioMutaiSTOML1
DMDMi60415942

Proteomic databases

jPOSTiQ9UBI4
MassIVEiQ9UBI4
MaxQBiQ9UBI4
PaxDbiQ9UBI4
PeptideAtlasiQ9UBI4
PRIDEiQ9UBI4
ProteomicsDBi17957
42124
5218
83973 [Q9UBI4-1]
83974 [Q9UBI4-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		26821, 123 antibodies

Genome annotation databases

EnsembliENST00000316900; ENSP00000319323; ENSG00000067221 [Q9UBI4-5]
ENST00000316911; ENSP00000319384; ENSG00000067221 [Q9UBI4-2]
ENST00000359750; ENSP00000352788; ENSG00000067221 [Q9UBI4-6]
ENST00000541638; ENSP00000442478; ENSG00000067221 [Q9UBI4-1]
ENST00000564777; ENSP00000456343; ENSG00000067221 [Q9UBI4-4]
GeneIDi9399
KEGGihsa:9399
UCSCiuc002awe.5, human [Q9UBI4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9399
DisGeNETi9399
EuPathDBiHostDB:ENSG00000067221.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		STOML1
HGNCiHGNC:14560, STOML1
HPAiENSG00000067221, Tissue enhanced (brain)
MIMi608326, gene
neXtProtiNX_Q9UBI4
OpenTargetsiENSG00000067221
PharmGKBiPA37898

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2621, Eukaryota
KOG4170, Eukaryota
GeneTreeiENSGT01010000222507
HOGENOMiCLU_049498_0_0_1
InParanoidiQ9UBI4
OMAiSFDYIPN
OrthoDBi1062075at2759
PhylomeDBiQ9UBI4
TreeFamiTF105750

Enzyme and pathway databases

PathwayCommonsiQ9UBI4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9399, 2 hits in 845 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		STOML1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		STOML1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9399
PharosiQ9UBI4, Tbio

Protein Ontology

More...PROi		PR:Q9UBI4
RNActiQ9UBI4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000067221, Expressed in tendon of biceps brachii and 234 other tissues
ExpressionAtlasiQ9UBI4, baseline and differential
GenevisibleiQ9UBI4, HS

Family and domain databases

Gene3Di3.30.1050.10, 1 hit
InterProiView protein in InterPro
IPR043202, Band-7_stomatin-like
IPR001107, Band_7
IPR036013, Band_7/SPFH_dom_sf
IPR003033, SCP2_sterol-bd_dom
IPR036527, SCP2_sterol-bd_dom_sf
IPR001972, Stomatin_HflK_HflKC_fam
PANTHERiPTHR10264, PTHR10264, 1 hit
PfamiView protein in Pfam
PF01145, Band_7, 1 hit
PF02036, SCP2, 1 hit
PRINTSiPR00721, STOMATIN
SMARTiView protein in SMART
SM00244, PHB, 1 hit
SUPFAMiSSF117892, SSF117892, 1 hit
SSF55718, SSF55718, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTML1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBI4
Secondary accession number(s): B3KQN0
, B4DUU5, B4DXM9, E7ESC0, H3BRP3, O95675, Q4PNR4, Q6FGL8, Q8WYI7, Q9UMB9, Q9UMC0, Q9Y6H9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: May 1, 2000
Last modified: December 2, 2020
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again