Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RING-box protein 2

Gene

RNF7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed:10851089). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.By similarity1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi50Zinc 1By similarity1
Metal bindingi53Zinc 1By similarity1
Metal bindingi61Zinc 3By similarity1
Metal bindingi64Zinc 3By similarity1
Metal bindingi73Zinc 3By similarity1
Metal bindingi80Zinc 2By similarity1
Metal bindingi82Zinc 2By similarity1
Metal bindingi85Zinc 1By similarity1
Metal bindingi87Zinc 3By similarity1
Metal bindingi88Zinc 1By similarity1
Metal bindingi99Zinc 2By similarity1
Metal bindingi102Zinc 2By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri61 – 103RING-typePROSITE-ProRule annotationAdd BLAST43

GO - Molecular functioni

  • copper ion binding Source: ProtInc
  • cullin family protein binding Source: MGI
  • NEDD8 transferase activity Source: UniProtKB
  • ubiquitin protein ligase activity Source: GO_Central
  • zinc ion binding Source: ProtInc

GO - Biological processi

Keywordsi

Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ9UBF6
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
RING-box protein 2
Short name:
Rbx2
Alternative name(s):
CKII beta-binding protein 1
Short name:
CKBBP1
RING finger protein 7
Regulator of cullins 2
Sensitive to apoptosis gene protein
Gene namesi
Name:RNF7
Synonyms:RBX2, ROC2, SAG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114125.13
HGNCiHGNC:10070 RNF7
MIMi603863 gene
neXtProtiNX_Q9UBF6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9616
OpenTargetsiENSG00000114125
PharmGKBiPA34444

Polymorphism and mutation databases

BioMutaiRNF7
DMDMi37538003

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000560232 – 113RING-box protein 2Add BLAST112

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei10Phosphothreonine; by CK21 Publication1

Post-translational modificationi

Phosphorylation by CK2 is required for efficient degradation of NFKBIA and CDKN1B.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9UBF6
MaxQBiQ9UBF6
PaxDbiQ9UBF6
PeptideAtlasiQ9UBF6
PRIDEiQ9UBF6
ProteomicsDBi83956
83957 [Q9UBF6-2]
83958 [Q9UBF6-3]

PTM databases

iPTMnetiQ9UBF6
PhosphoSitePlusiQ9UBF6

Expressioni

Tissue specificityi

Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung.1 Publication

Inductioni

By 1,10-phenanthroline.1 Publication

Gene expression databases

BgeeiENSG00000114125 Expressed in 220 organ(s), highest expression level in quadriceps femoris
CleanExiHS_RNF7
HS_SAG
ExpressionAtlasiQ9UBF6 baseline and differential
GenevisibleiQ9UBF6 HS

Organism-specific databases

HPAiHPA036995

Interactioni

Subunit structurei

Probable part of SCF complexes, which consist of SKP1, CUL1, RNF7/RBX2 and a F-box protein. Interacts (preferentially) with CUL5. Also interacts (with lower preference) with CUL1, CUL2, CUL3, CUL4A and CUL4B. Interacts with UBE2F. Interacts with CSNK2B, the interaction is not affected by phosphorylation by CK2.3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114977, 108 interactors
CORUMiQ9UBF6
IntActiQ9UBF6, 28 interactors
MINTiQ9UBF6
STRINGi9606.ENSP00000273480

Structurei

Secondary structure

1113
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9UBF6
SMRiQ9UBF6
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UBF6

Family & Domainsi

Domaini

The RING-type zinc finger domain is essential for ubiquitin ligase activity. It coordinates an additional third zinc ion.

Sequence similaritiesi

Belongs to the RING-box family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri61 – 103RING-typePROSITE-ProRule annotationAdd BLAST43

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG2930 Eukaryota
COG5194 LUCA
GeneTreeiENSGT00390000017058
HOGENOMiHOG000171951
HOVERGENiHBG001507
InParanoidiQ9UBF6
KOiK10611
OMAiVLKKWNA
OrthoDBiEOG091G0TA5
PhylomeDBiQ9UBF6
TreeFamiTF351049

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR024766 Znf_RING_H2
PfamiView protein in Pfam
PF12678 zf-rbx1, 1 hit
PROSITEiView protein in PROSITE
PS50089 ZF_RING_2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBF6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADVEDGEET CALASHSGSS GSKSGGDKMF SLKKWNAVAM WSWDVECDTC
60 70 80 90 100
AICRVQVMDA CLRCQAENKQ EDCVVVWGEC NHSFHNCCMS LWVKQNNRCP
110
LCQQDWVVQR IGK
Length:113
Mass (Da):12,683
Last modified:May 1, 2000 - v1
Checksum:iCE1E6CAC940C8257
GO
Isoform 2 (identifier: Q9UBF6-2) [UniParc]FASTAAdd to basket
Also known as: SAG-v

The sequence of this isoform differs from the canonical sequence as follows:
     60-113: ACLRCQAENK...QDWVVQRIGK → EGIGVRNWSE...SHQPCLDDHR

Note: Inactive.
Show »
Length:108
Mass (Da):11,557
Checksum:i77A887E012AEE520
GO
Isoform 3 (identifier: Q9UBF6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     57-113: VMDACLRCQA...QDWVVQRIGK → MPVLDVKLKTNKRTVLWSGENVIIPSTTAACPCG

Show »
Length:90
Mass (Da):9,642
Checksum:iE26F96D19B016540
GO
Isoform 4 (identifier: Q9UBF6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-74: Missing.

Note: No experimental confirmation available.
Show »
Length:97
Mass (Da):10,876
Checksum:i5277FEE26DCEB81F
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WEU8F8WEU8_HUMAN
RING-box protein 2
RNF7
68Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23K → T in AAD30147 (PubMed:10230407).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04144457 – 113VMDAC…QRIGK → MPVLDVKLKTNKRTVLWSGE NVIIPSTTAACPCG in isoform 3. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_04452559 – 74Missing in isoform 4. CuratedAdd BLAST16
Alternative sequenceiVSP_00844960 – 113ACLRC…QRIGK → EGIGVRNWSEALNLINASEM GFDCRSGSTALAVPSVSLAS HQPCLDDHR in isoform 2. 2 PublicationsAdd BLAST54

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF164679 mRNA Translation: AAD55984.1
AF142060 mRNA Translation: AAD30147.1
AF092878 mRNA Translation: AAD25962.1
AF312226 mRNA Translation: AAK37450.1
BT007348 mRNA Translation: AAP36012.1
AK289894 mRNA Translation: BAF82583.1
DB272382 mRNA No translation available.
AC112771 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78991.1
CH471052 Genomic DNA Translation: EAW78992.1
CH471052 Genomic DNA Translation: EAW78994.1
CH471052 Genomic DNA Translation: EAW78995.1
CH471052 Genomic DNA Translation: EAW78996.1
BC005966 mRNA Translation: AAH05966.1
BC008627 mRNA Translation: AAH08627.1
CCDSiCCDS3118.1 [Q9UBF6-1]
CCDS43158.1 [Q9UBF6-3]
CCDS56283.1 [Q9UBF6-4]
RefSeqiNP_001188299.1, NM_001201370.1 [Q9UBF6-4]
NP_055060.1, NM_014245.4 [Q9UBF6-1]
NP_899060.1, NM_183237.2 [Q9UBF6-3]
UniGeneiHs.134623

Genome annotation databases

EnsembliENST00000273480; ENSP00000273480; ENSG00000114125 [Q9UBF6-1]
ENST00000393000; ENSP00000376725; ENSG00000114125 [Q9UBF6-3]
ENST00000477012; ENSP00000419339; ENSG00000114125 [Q9UBF6-2]
ENST00000480908; ENSP00000419084; ENSG00000114125 [Q9UBF6-4]
GeneIDi9616
KEGGihsa:9616
UCSCiuc003euc.4 human [Q9UBF6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF164679 mRNA Translation: AAD55984.1
AF142060 mRNA Translation: AAD30147.1
AF092878 mRNA Translation: AAD25962.1
AF312226 mRNA Translation: AAK37450.1
BT007348 mRNA Translation: AAP36012.1
AK289894 mRNA Translation: BAF82583.1
DB272382 mRNA No translation available.
AC112771 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78991.1
CH471052 Genomic DNA Translation: EAW78992.1
CH471052 Genomic DNA Translation: EAW78994.1
CH471052 Genomic DNA Translation: EAW78995.1
CH471052 Genomic DNA Translation: EAW78996.1
BC005966 mRNA Translation: AAH05966.1
BC008627 mRNA Translation: AAH08627.1
CCDSiCCDS3118.1 [Q9UBF6-1]
CCDS43158.1 [Q9UBF6-3]
CCDS56283.1 [Q9UBF6-4]
RefSeqiNP_001188299.1, NM_001201370.1 [Q9UBF6-4]
NP_055060.1, NM_014245.4 [Q9UBF6-1]
NP_899060.1, NM_183237.2 [Q9UBF6-3]
UniGeneiHs.134623

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ECLNMR-A40-113[»]
ProteinModelPortaliQ9UBF6
SMRiQ9UBF6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114977, 108 interactors
CORUMiQ9UBF6
IntActiQ9UBF6, 28 interactors
MINTiQ9UBF6
STRINGi9606.ENSP00000273480

PTM databases

iPTMnetiQ9UBF6
PhosphoSitePlusiQ9UBF6

Polymorphism and mutation databases

BioMutaiRNF7
DMDMi37538003

Proteomic databases

EPDiQ9UBF6
MaxQBiQ9UBF6
PaxDbiQ9UBF6
PeptideAtlasiQ9UBF6
PRIDEiQ9UBF6
ProteomicsDBi83956
83957 [Q9UBF6-2]
83958 [Q9UBF6-3]

Protocols and materials databases

DNASUi9616
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000273480; ENSP00000273480; ENSG00000114125 [Q9UBF6-1]
ENST00000393000; ENSP00000376725; ENSG00000114125 [Q9UBF6-3]
ENST00000477012; ENSP00000419339; ENSG00000114125 [Q9UBF6-2]
ENST00000480908; ENSP00000419084; ENSG00000114125 [Q9UBF6-4]
GeneIDi9616
KEGGihsa:9616
UCSCiuc003euc.4 human [Q9UBF6-1]

Organism-specific databases

CTDi9616
DisGeNETi9616
EuPathDBiHostDB:ENSG00000114125.13
GeneCardsiRNF7
HGNCiHGNC:10070 RNF7
HPAiHPA036995
MIMi603863 gene
neXtProtiNX_Q9UBF6
OpenTargetsiENSG00000114125
PharmGKBiPA34444
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2930 Eukaryota
COG5194 LUCA
GeneTreeiENSGT00390000017058
HOGENOMiHOG000171951
HOVERGENiHBG001507
InParanoidiQ9UBF6
KOiK10611
OMAiVLKKWNA
OrthoDBiEOG091G0TA5
PhylomeDBiQ9UBF6
TreeFamiTF351049

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ9UBF6

Miscellaneous databases

ChiTaRSiRNF7 human
EvolutionaryTraceiQ9UBF6
GeneWikiiRNF7
GenomeRNAii9616
PROiPR:Q9UBF6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114125 Expressed in 220 organ(s), highest expression level in quadriceps femoris
CleanExiHS_RNF7
HS_SAG
ExpressionAtlasiQ9UBF6 baseline and differential
GenevisibleiQ9UBF6 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR024766 Znf_RING_H2
PfamiView protein in Pfam
PF12678 zf-rbx1, 1 hit
PROSITEiView protein in PROSITE
PS50089 ZF_RING_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRBX2_HUMAN
AccessioniPrimary (citable) accession number: Q9UBF6
Secondary accession number(s): A8K1H9
, A8MTB5, C9JYL3, D3DNF7, D3DNF8, Q9BXN8, Q9Y5M7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 158 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again