Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9UBC2 (EP15R_HUMAN)

Protein

Epidermal growth factor receptor substrate 15-like 1

Gene

EPS15L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Seems to be a constitutive component of clathrin-coated pits that is required for receptor-mediated endocytosis. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2.2 Publications

Caution

Studies in clathrin-mediated endocytosis used a siRNA mixture of EPS15 and EPS15L1.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi172 – 184PROSITE-ProRule annotationAdd BLAST13

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-182971 EGFR downregulation
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q9UBC2 Curated

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Epidermal growth factor receptor substrate 15-like 1
Alternative name(s):
Eps15-related protein
Short name:
Eps15R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EPS15L1
Synonyms:EPS15R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000127527.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:24634 EPS15L1

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9UBC2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Coated pit, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		58513

MalaCards human disease database

More...MalaCardsi		EPS15L1

Open Targets

More...OpenTargetsi		ENSG00000127527

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2440 Isolated split hand-split foot malformation

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134906266

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		EPS15L1

Domain mapping of disease mutations (DMDM)

More...DMDMi		61223942

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001461182 – 864Epidermal growth factor receptor substrate 15-like 1Add BLAST863

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei74PhosphotyrosineBy similarity1
Modified residuei107PhosphoserineBy similarity1
Modified residuei108PhosphoserineCombined sources1
Modified residuei229PhosphoserineCombined sources1
Modified residuei244PhosphoserineCombined sources1
Modified residuei253PhosphoserineCombined sources1
Modified residuei255PhosphoserineCombined sources1
Modified residuei259PhosphoserineCombined sources1
Modified residuei362PhosphoserineBy similarity1
Modified residuei366PhosphothreonineCombined sources1
Modified residuei371PhosphoserineCombined sources1
Modified residuei374PhosphoserineCombined sources1
Modified residuei377PhosphoserineCombined sources1
Modified residuei560PhosphoserineCombined sources1
Modified residuei564PhosphotyrosineBy similarity1
Modified residuei577PhosphothreonineCombined sources1
Modified residuei593PhosphoserineCombined sources1
Modified residuei666PhosphoserineCombined sources1
Modified residuei672PhosphoserineCombined sources1
Modified residuei697PhosphoserineCombined sources1
Modified residuei717PhosphoserineCombined sources1
Modified residuei734PhosphoserineCombined sources1
Modified residuei793PhosphoserineCombined sources1
Modified residuei797PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues by EGFR.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9UBC2

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9UBC2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9UBC2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9UBC2

PeptideAtlas

More...PeptideAtlasi		Q9UBC2

PRoteomics IDEntifications database

More...PRIDEi		Q9UBC2

ProteomicsDB human proteome resource

More...ProteomicsDBi		83933
83934 [Q9UBC2-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9UBC2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9UBC2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000127527 Expressed in 196 organ(s), highest expression level in gastrocnemius

CleanEx database of gene expression profiles

More...CleanExi		HS_EPS15L1

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9UBC2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9UBC2 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA019237
HPA055309

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EPS15, AGFG1/HRB and AGFG2/HRBL. Associates with the clathrin-associated adapter protein complex 2 (AP-2) (By similarity). Interacts with FCHO1. Interacts with FCHO2. Interacts (via EH domains) with DAB2. Interacts with UBQLN1 (via ubiquitin-like domain). Interacts with CAVIN3 (via leucine-zipper domain) (PubMed:19262564).By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		121840, 74 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q9UBC2

Protein interaction database and analysis system

More...IntActi		Q9UBC2, 25 interactors

Molecular INTeraction database

More...MINTi		Q9UBC2

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000248070

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q9UBC2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9UBC2

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini15 – 104EH 1PROSITE-ProRule annotationAdd BLAST90
Domaini127 – 215EH 2PROSITE-ProRule annotationAdd BLAST89
Domaini159 – 194EF-handPROSITE-ProRule annotationAdd BLAST36
Domaini275 – 365EH 3PROSITE-ProRule annotationAdd BLAST91
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati618 – 62013
Repeati640 – 64223
Repeati645 – 64733
Repeati650 – 65243
Repeati656 – 65853
Repeati661 – 66363
Repeati667 – 66973
Repeati685 – 68783
Repeati690 – 69293
Repeati709 – 711103
Repeati728 – 730113
Repeati754 – 756123
Repeati806 – 808133
Repeati812 – 814143
Repeati833 – 835153

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni15 – 368Interaction with DAB2By similarityAdd BLAST354
Regioni618 – 83515 X 3 AA repeats of D-P-FAdd BLAST218

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili386 – 553Sequence analysisAdd BLAST168

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi750 – 816Pro-richAdd BLAST67

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0998 Eukaryota
ENOG410XTDR LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155438

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000004804

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG005591

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9UBC2

KEGG Orthology (KO)

More...KOi		K12472

Identification of Orthologs from Complete Genome Data

More...OMAi		QELHTDP

Database of Orthologous Groups

More...OrthoDBi		597979at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9UBC2

TreeFam database of animal gene trees

More...TreeFami		TF324293

Family and domain databases

Conserved Domains Database

More...CDDi		cd00052 EH, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12763 EF-hand_4, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00054 EFh, 3 hits
SM00027 EH, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473 SSF47473, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 4 hits
PS50031 EH, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBC2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPLIPLSQ QIPTGNSLYE SYYKQVDPAY TGRVGASEAA LFLKKSGLSD 
        60         70         80         90        100
IILGKIWDLA DPEGKGFLDK QGFYVALRLV ACAQSGHEVT LSNLNLSMPP 
       110        120        130        140        150
PKFHDTSSPL MVTPPSAEAH WAVRVEEKAK FDGIFESLLP INGLLSGDKV 
       160        170        180        190        200
KPVLMNSKLP LDVLGRVWDL SDIDKDGHLD RDEFAVAMHL VYRALEKEPV 
       210        220        230        240        250
PSALPPSLIP PSKRKKTVFP GAVPVLPASP PPKDSLRSTP SHGSVSSLNS 
       260        270        280        290        300
TGSLSPKHSL KQTQPTVNWV VPVADKMRFD EIFLKTDLDL DGYVSGQEVK 
       310        320        330        340        350
EIFMHSGLTQ NLLAHIWALA DTRQTGKLSK DQFALAMYFI QQKVSKGIDP 
       360        370        380        390        400
PQVLSPDMVP PSERGTPGPD SSGSLGSGEF TGVKELDDIS QEIAQLQREK 
       410        420        430        440        450
YSLEQDIREK EEAIRQKTSE VQELQNDLDR ETSSLQELEA QKQDAQDRLD 
       460        470        480        490        500
EMDQQKAKLR DMLSDVRQKC QDETQMISSL KTQIQSQESD LKSQEDDLNR 
       510        520        530        540        550
AKSELNRLQQ EETQLEQSIQ AGRVQLETII KSLKSTQDEI NQARSKLSQL 
       560        570        580        590        600
HESRQEAHRS LEQYDQVLDG AHGASLTDLA NLSEGVSLAE RGSFGAMDDP 
       610        620        630        640        650
FKNKALLFSN NTQELHPDPF QTEDPFKSDP FKGADPFKGD PFQNDPFAEQ 
       660        670        680        690        700
QTTSTDPFGG DPFKESDPFR GSATDDFFKK QTKNDPFTSD PFTKNPSLPS 
       710        720        730        740        750
KLDPFESSDP FSSSSVSSKG SDPFGTLDPF GSGSFNSAEG FADFSQMSKP 
       760        770        780        790        800
PPSGPFTSSL GGAGFSDDPF KSKQDTPALP PKKPAPPRPK PPSGKSTPVS 
       810        820        830        840        850
QLGSADFPEA PDPFQPLGAD SGDPFQSKKG FGDPFSGKDP FVPSSAAKPS 
       860 
KASASGFADF TSVS
Length:864
Mass (Da):94,255
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF4126069F6E00387
GO
Isoform 2 (identifier: Q9UBC2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     863-864: VS → FGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAIALSKADMPAA

Show »
Length:910
Mass (Da):99,606
Checksum:iF56CC554F539B5FE
GO
Isoform 3 (identifier: Q9UBC2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     750-864: PPPSGPFTSS...SGFADFTSVS → VKVHL

Show »
Length:754
Mass (Da):83,248
Checksum:i5FFC0740FA78FC8B
GO
Isoform 4 (identifier: Q9UBC2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-601: DDPF → VKVE
     602-864: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):66,479
Checksum:i9709A5D16D1E126A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R165M0R165_HUMAN
Epidermal growth factor receptor su...
EPS15L1
756Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R2S2M0R2S2_HUMAN
Epidermal growth factor receptor su...
EPS15L1
447Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QY01M0QY01_HUMAN
Epidermal growth factor receptor su...
EPS15L1
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1V5M0R1V5_HUMAN
Epidermal growth factor receptor su...
EPS15L1
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QX30M0QX30_HUMAN
Epidermal growth factor receptor su...
EPS15L1
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJR2K7EJR2_HUMAN
Epidermal growth factor receptor su...
EPS15L1
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R330M0R330_HUMAN
Epidermal growth factor receptor su...
EPS15L1
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R3I1M0R3I1_HUMAN
Epidermal growth factor receptor su...
EPS15L1
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti680K → E in BAG59115 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046904598 – 601DDPF → VKVE in isoform 4. 1 Publication4
Alternative sequenceiVSP_046905602 – 864Missing in isoform 4. 1 PublicationAdd BLAST263
Alternative sequenceiVSP_045429750 – 864PPPSG…FTSVS → VKVHL in isoform 3. 2 PublicationsAdd BLAST115
Alternative sequenceiVSP_042200863 – 864VS → FGNEEQQLAWAKRESEKAEQ ERLARLRRQEQEDLELAIAL SKADMPAA in isoform 2. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF110265 mRNA Translation: AAF21930.1
AB015346 mRNA Translation: BAA88118.1
AK024166 mRNA Translation: BAG51266.1
AK296473 mRNA Translation: BAG59115.1
AC008764 Genomic DNA No translation available.
AC020917 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84542.1
BC131590 mRNA Translation: AAI31591.1
BC142716 mRNA Translation: AAI42717.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32944.1 [Q9UBC2-1]
CCDS58653.1 [Q9UBC2-3]
CCDS58654.1 [Q9UBC2-2]
CCDS59363.1 [Q9UBC2-4]

NCBI Reference Sequences

More...RefSeqi		NP_001245303.1, NM_001258374.1 [Q9UBC2-2]
NP_001245304.1, NM_001258375.1 [Q9UBC2-3]
NP_001245305.1, NM_001258376.1 [Q9UBC2-4]
NP_067058.1, NM_021235.2 [Q9UBC2-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.654639
Hs.683428
Hs.744842

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000248070; ENSP00000248070; ENSG00000127527 [Q9UBC2-1]
ENST00000455140; ENSP00000393313; ENSG00000127527 [Q9UBC2-2]
ENST00000535753; ENSP00000440103; ENSG00000127527 [Q9UBC2-3]
ENST00000597937; ENSP00000472267; ENSG00000127527 [Q9UBC2-4]
ENST00000602022; ENSP00000471981; ENSG00000127527 [Q9UBC2-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		58513

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:58513

UCSC genome browser

More...UCSCi		uc002ndx.5 human [Q9UBC2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF110265 mRNA Translation: AAF21930.1
AB015346 mRNA Translation: BAA88118.1
AK024166 mRNA Translation: BAG51266.1
AK296473 mRNA Translation: BAG59115.1
AC008764 Genomic DNA No translation available.
AC020917 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84542.1
BC131590 mRNA Translation: AAI31591.1
BC142716 mRNA Translation: AAI42717.1
CCDSiCCDS32944.1 [Q9UBC2-1]
CCDS58653.1 [Q9UBC2-3]
CCDS58654.1 [Q9UBC2-2]
CCDS59363.1 [Q9UBC2-4]
RefSeqiNP_001245303.1, NM_001258374.1 [Q9UBC2-2]
NP_001245304.1, NM_001258375.1 [Q9UBC2-3]
NP_001245305.1, NM_001258376.1 [Q9UBC2-4]
NP_067058.1, NM_021235.2 [Q9UBC2-1]
UniGeneiHs.654639
Hs.683428
Hs.744842

3D structure databases

ProteinModelPortaliQ9UBC2
SMRiQ9UBC2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121840, 74 interactors
ELMiQ9UBC2
IntActiQ9UBC2, 25 interactors
MINTiQ9UBC2
STRINGi9606.ENSP00000248070

Protein family/group databases

MoonDBiQ9UBC2 Curated

PTM databases

iPTMnetiQ9UBC2
PhosphoSitePlusiQ9UBC2

Polymorphism and mutation databases

BioMutaiEPS15L1
DMDMi61223942

Proteomic databases

EPDiQ9UBC2
jPOSTiQ9UBC2
MaxQBiQ9UBC2
PaxDbiQ9UBC2
PeptideAtlasiQ9UBC2
PRIDEiQ9UBC2
ProteomicsDBi83933
83934 [Q9UBC2-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248070; ENSP00000248070; ENSG00000127527 [Q9UBC2-1]
ENST00000455140; ENSP00000393313; ENSG00000127527 [Q9UBC2-2]
ENST00000535753; ENSP00000440103; ENSG00000127527 [Q9UBC2-3]
ENST00000597937; ENSP00000472267; ENSG00000127527 [Q9UBC2-4]
ENST00000602022; ENSP00000471981; ENSG00000127527 [Q9UBC2-3]
GeneIDi58513
KEGGihsa:58513
UCSCiuc002ndx.5 human [Q9UBC2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		58513
DisGeNETi58513
EuPathDBiHostDB:ENSG00000127527.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		EPS15L1
HGNCiHGNC:24634 EPS15L1
HPAiHPA019237
HPA055309
MalaCardsiEPS15L1
neXtProtiNX_Q9UBC2
OpenTargetsiENSG00000127527
Orphaneti2440 Isolated split hand-split foot malformation
PharmGKBiPA134906266

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0998 Eukaryota
ENOG410XTDR LUCA
GeneTreeiENSGT00940000155438
HOGENOMiHOG000004804
HOVERGENiHBG005591
InParanoidiQ9UBC2
KOiK12472
OMAiQELHTDP
OrthoDBi597979at2759
PhylomeDBiQ9UBC2
TreeFamiTF324293

Enzyme and pathway databases

ReactomeiR-HSA-182971 EGFR downregulation
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		EPS15L1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		EPS15L1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		58513

Protein Ontology

More...PROi		PR:Q9UBC2

Gene expression databases

BgeeiENSG00000127527 Expressed in 196 organ(s), highest expression level in gastrocnemius
CleanExiHS_EPS15L1
ExpressionAtlasiQ9UBC2 baseline and differential
GenevisibleiQ9UBC2 HS

Family and domain databases

CDDicd00052 EH, 3 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom
PfamiView protein in Pfam
PF12763 EF-hand_4, 3 hits
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SM00027 EH, 3 hits
SUPFAMiSSF47473 SSF47473, 3 hits
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 4 hits
PS50031 EH, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEP15R_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UBC2
Secondary accession number(s): A2RRF3, A5PL29, B4DKA3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: May 1, 2000
Last modified: January 16, 2019
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again