Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Epidermal growth factor receptor substrate 15-like 1

Gene

EPS15L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Seems to be a constitutive component of clathrin-coated pits that is required for receptor-mediated endocytosis. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2.2 Publications

Caution

Studies in clathrin-mediated endocytosis used a siRNA mixture of EPS15 and EPS15L1.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi172 – 184PROSITE-ProRule annotationAdd BLAST13

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processEndocytosis
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-182971 EGFR downregulation
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis

Protein family/group databases

MoonDBiQ9UBC2 Curated

Names & Taxonomyi

Protein namesi
Recommended name:
Epidermal growth factor receptor substrate 15-like 1
Alternative name(s):
Eps15-related protein
Short name:
Eps15R
Gene namesi
Name:EPS15L1
Synonyms:EPS15R
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000127527.13
HGNCiHGNC:24634 EPS15L1
neXtProtiNX_Q9UBC2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Coated pit, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi58513
MalaCardsiEPS15L1
OpenTargetsiENSG00000127527
Orphaneti2440 Isolated split hand-split foot malformation
PharmGKBiPA134906266

Polymorphism and mutation databases

BioMutaiEPS15L1
DMDMi61223942

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001461182 – 864Epidermal growth factor receptor substrate 15-like 1Add BLAST863

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei74PhosphotyrosineBy similarity1
Modified residuei107PhosphoserineBy similarity1
Modified residuei108PhosphoserineCombined sources1
Modified residuei229PhosphoserineCombined sources1
Modified residuei244PhosphoserineCombined sources1
Modified residuei253PhosphoserineCombined sources1
Modified residuei255PhosphoserineCombined sources1
Modified residuei259PhosphoserineCombined sources1
Modified residuei362PhosphoserineBy similarity1
Modified residuei366PhosphothreonineCombined sources1
Modified residuei371PhosphoserineCombined sources1
Modified residuei374PhosphoserineCombined sources1
Modified residuei377PhosphoserineCombined sources1
Modified residuei560PhosphoserineCombined sources1
Modified residuei564PhosphotyrosineBy similarity1
Modified residuei577PhosphothreonineCombined sources1
Modified residuei593PhosphoserineCombined sources1
Modified residuei666PhosphoserineCombined sources1
Modified residuei672PhosphoserineCombined sources1
Modified residuei697PhosphoserineCombined sources1
Modified residuei717PhosphoserineCombined sources1
Modified residuei734PhosphoserineCombined sources1
Modified residuei793PhosphoserineCombined sources1
Modified residuei797PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylated on tyrosine residues by EGFR.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9UBC2
MaxQBiQ9UBC2
PaxDbiQ9UBC2
PeptideAtlasiQ9UBC2
PRIDEiQ9UBC2
ProteomicsDBi83933
83934 [Q9UBC2-2]

PTM databases

iPTMnetiQ9UBC2
PhosphoSitePlusiQ9UBC2

Expressioni

Gene expression databases

BgeeiENSG00000127527 Expressed in 196 organ(s), highest expression level in gastrocnemius
CleanExiHS_EPS15L1
ExpressionAtlasiQ9UBC2 baseline and differential
GenevisibleiQ9UBC2 HS

Organism-specific databases

HPAiHPA019237
HPA055309

Interactioni

Subunit structurei

Interacts with EPS15, AGFG1/HRB and AGFG2/HRBL. Associates with the clathrin-associated adapter protein complex 2 (AP-2) (By similarity). Interacts with FCHO1. Interacts with FCHO2. Interacts (via EH domains) with DAB2. Interacts with UBQLN1 (via ubiquitin-like domain). Interacts with CAVIN3 (via leucine-zipper domain) (PubMed:19262564).By similarity5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121840, 74 interactors
ELMiQ9UBC2
IntActiQ9UBC2, 25 interactors
MINTiQ9UBC2
STRINGi9606.ENSP00000248070

Structurei

3D structure databases

ProteinModelPortaliQ9UBC2
SMRiQ9UBC2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini15 – 104EH 1PROSITE-ProRule annotationAdd BLAST90
Domaini127 – 215EH 2PROSITE-ProRule annotationAdd BLAST89
Domaini159 – 194EF-handPROSITE-ProRule annotationAdd BLAST36
Domaini275 – 365EH 3PROSITE-ProRule annotationAdd BLAST91
Repeati618 – 62013
Repeati640 – 64223
Repeati645 – 64733
Repeati650 – 65243
Repeati656 – 65853
Repeati661 – 66363
Repeati667 – 66973
Repeati685 – 68783
Repeati690 – 69293
Repeati709 – 711103
Repeati728 – 730113
Repeati754 – 756123
Repeati806 – 808133
Repeati812 – 814143
Repeati833 – 835153

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni15 – 368Interaction with DAB2By similarityAdd BLAST354
Regioni618 – 83515 X 3 AA repeats of D-P-FAdd BLAST218

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili386 – 553Sequence analysisAdd BLAST168

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi750 – 816Pro-richAdd BLAST67

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0998 Eukaryota
ENOG410XTDR LUCA
GeneTreeiENSGT00760000118985
HOGENOMiHOG000004804
HOVERGENiHBG005591
InParanoidiQ9UBC2
KOiK12472
OMAiQELHTDP
OrthoDBiEOG091G01RG
PhylomeDBiQ9UBC2
TreeFamiTF324293

Family and domain databases

CDDicd00052 EH, 3 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom
PfamiView protein in Pfam
PF12763 EF-hand_4, 3 hits
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SM00027 EH, 3 hits
SUPFAMiSSF47473 SSF47473, 3 hits
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 4 hits
PS50031 EH, 3 hits

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UBC2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPLIPLSQ QIPTGNSLYE SYYKQVDPAY TGRVGASEAA LFLKKSGLSD
60 70 80 90 100
IILGKIWDLA DPEGKGFLDK QGFYVALRLV ACAQSGHEVT LSNLNLSMPP
110 120 130 140 150
PKFHDTSSPL MVTPPSAEAH WAVRVEEKAK FDGIFESLLP INGLLSGDKV
160 170 180 190 200
KPVLMNSKLP LDVLGRVWDL SDIDKDGHLD RDEFAVAMHL VYRALEKEPV
210 220 230 240 250
PSALPPSLIP PSKRKKTVFP GAVPVLPASP PPKDSLRSTP SHGSVSSLNS
260 270 280 290 300
TGSLSPKHSL KQTQPTVNWV VPVADKMRFD EIFLKTDLDL DGYVSGQEVK
310 320 330 340 350
EIFMHSGLTQ NLLAHIWALA DTRQTGKLSK DQFALAMYFI QQKVSKGIDP
360 370 380 390 400
PQVLSPDMVP PSERGTPGPD SSGSLGSGEF TGVKELDDIS QEIAQLQREK
410 420 430 440 450
YSLEQDIREK EEAIRQKTSE VQELQNDLDR ETSSLQELEA QKQDAQDRLD
460 470 480 490 500
EMDQQKAKLR DMLSDVRQKC QDETQMISSL KTQIQSQESD LKSQEDDLNR
510 520 530 540 550
AKSELNRLQQ EETQLEQSIQ AGRVQLETII KSLKSTQDEI NQARSKLSQL
560 570 580 590 600
HESRQEAHRS LEQYDQVLDG AHGASLTDLA NLSEGVSLAE RGSFGAMDDP
610 620 630 640 650
FKNKALLFSN NTQELHPDPF QTEDPFKSDP FKGADPFKGD PFQNDPFAEQ
660 670 680 690 700
QTTSTDPFGG DPFKESDPFR GSATDDFFKK QTKNDPFTSD PFTKNPSLPS
710 720 730 740 750
KLDPFESSDP FSSSSVSSKG SDPFGTLDPF GSGSFNSAEG FADFSQMSKP
760 770 780 790 800
PPSGPFTSSL GGAGFSDDPF KSKQDTPALP PKKPAPPRPK PPSGKSTPVS
810 820 830 840 850
QLGSADFPEA PDPFQPLGAD SGDPFQSKKG FGDPFSGKDP FVPSSAAKPS
860
KASASGFADF TSVS
Length:864
Mass (Da):94,255
Last modified:May 1, 2000 - v1
Checksum:iF4126069F6E00387
GO
Isoform 2 (identifier: Q9UBC2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     863-864: VS → FGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAIALSKADMPAA

Show »
Length:910
Mass (Da):99,606
Checksum:iF56CC554F539B5FE
GO
Isoform 3 (identifier: Q9UBC2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     750-864: PPPSGPFTSS...SGFADFTSVS → VKVHL

Show »
Length:754
Mass (Da):83,248
Checksum:i5FFC0740FA78FC8B
GO
Isoform 4 (identifier: Q9UBC2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-601: DDPF → VKVE
     602-864: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):66,479
Checksum:i9709A5D16D1E126A
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R165M0R165_HUMAN
Epidermal growth factor receptor su...
EPS15L1
756Annotation score:
M0R2S2M0R2S2_HUMAN
Epidermal growth factor receptor su...
EPS15L1
447Annotation score:
M0QY01M0QY01_HUMAN
Epidermal growth factor receptor su...
EPS15L1
71Annotation score:
M0R1V5M0R1V5_HUMAN
Epidermal growth factor receptor su...
EPS15L1
110Annotation score:
M0QX30M0QX30_HUMAN
Epidermal growth factor receptor su...
EPS15L1
90Annotation score:
K7EJR2K7EJR2_HUMAN
Epidermal growth factor receptor su...
EPS15L1
79Annotation score:
M0R330M0R330_HUMAN
Epidermal growth factor receptor su...
EPS15L1
83Annotation score:
M0R3I1M0R3I1_HUMAN
Epidermal growth factor receptor su...
EPS15L1
213Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti680K → E in BAG59115 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_046904598 – 601DDPF → VKVE in isoform 4. 1 Publication4
Alternative sequenceiVSP_046905602 – 864Missing in isoform 4. 1 PublicationAdd BLAST263
Alternative sequenceiVSP_045429750 – 864PPPSG…FTSVS → VKVHL in isoform 3. 2 PublicationsAdd BLAST115
Alternative sequenceiVSP_042200863 – 864VS → FGNEEQQLAWAKRESEKAEQ ERLARLRRQEQEDLELAIAL SKADMPAA in isoform 2. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF110265 mRNA Translation: AAF21930.1
AB015346 mRNA Translation: BAA88118.1
AK024166 mRNA Translation: BAG51266.1
AK296473 mRNA Translation: BAG59115.1
AC008764 Genomic DNA No translation available.
AC020917 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84542.1
BC131590 mRNA Translation: AAI31591.1
BC142716 mRNA Translation: AAI42717.1
CCDSiCCDS32944.1 [Q9UBC2-1]
CCDS58653.1 [Q9UBC2-3]
CCDS58654.1 [Q9UBC2-2]
CCDS59363.1 [Q9UBC2-4]
RefSeqiNP_001245303.1, NM_001258374.1 [Q9UBC2-2]
NP_001245304.1, NM_001258375.1 [Q9UBC2-3]
NP_001245305.1, NM_001258376.1 [Q9UBC2-4]
NP_067058.1, NM_021235.2 [Q9UBC2-1]
UniGeneiHs.654639
Hs.683428
Hs.744842

Genome annotation databases

EnsembliENST00000248070; ENSP00000248070; ENSG00000127527 [Q9UBC2-1]
ENST00000455140; ENSP00000393313; ENSG00000127527 [Q9UBC2-2]
ENST00000535753; ENSP00000440103; ENSG00000127527 [Q9UBC2-3]
ENST00000597937; ENSP00000472267; ENSG00000127527 [Q9UBC2-4]
ENST00000602022; ENSP00000471981; ENSG00000127527 [Q9UBC2-3]
GeneIDi58513
KEGGihsa:58513
UCSCiuc002ndx.5 human [Q9UBC2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF110265 mRNA Translation: AAF21930.1
AB015346 mRNA Translation: BAA88118.1
AK024166 mRNA Translation: BAG51266.1
AK296473 mRNA Translation: BAG59115.1
AC008764 Genomic DNA No translation available.
AC020917 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84542.1
BC131590 mRNA Translation: AAI31591.1
BC142716 mRNA Translation: AAI42717.1
CCDSiCCDS32944.1 [Q9UBC2-1]
CCDS58653.1 [Q9UBC2-3]
CCDS58654.1 [Q9UBC2-2]
CCDS59363.1 [Q9UBC2-4]
RefSeqiNP_001245303.1, NM_001258374.1 [Q9UBC2-2]
NP_001245304.1, NM_001258375.1 [Q9UBC2-3]
NP_001245305.1, NM_001258376.1 [Q9UBC2-4]
NP_067058.1, NM_021235.2 [Q9UBC2-1]
UniGeneiHs.654639
Hs.683428
Hs.744842

3D structure databases

ProteinModelPortaliQ9UBC2
SMRiQ9UBC2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121840, 74 interactors
ELMiQ9UBC2
IntActiQ9UBC2, 25 interactors
MINTiQ9UBC2
STRINGi9606.ENSP00000248070

Protein family/group databases

MoonDBiQ9UBC2 Curated

PTM databases

iPTMnetiQ9UBC2
PhosphoSitePlusiQ9UBC2

Polymorphism and mutation databases

BioMutaiEPS15L1
DMDMi61223942

Proteomic databases

EPDiQ9UBC2
MaxQBiQ9UBC2
PaxDbiQ9UBC2
PeptideAtlasiQ9UBC2
PRIDEiQ9UBC2
ProteomicsDBi83933
83934 [Q9UBC2-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248070; ENSP00000248070; ENSG00000127527 [Q9UBC2-1]
ENST00000455140; ENSP00000393313; ENSG00000127527 [Q9UBC2-2]
ENST00000535753; ENSP00000440103; ENSG00000127527 [Q9UBC2-3]
ENST00000597937; ENSP00000472267; ENSG00000127527 [Q9UBC2-4]
ENST00000602022; ENSP00000471981; ENSG00000127527 [Q9UBC2-3]
GeneIDi58513
KEGGihsa:58513
UCSCiuc002ndx.5 human [Q9UBC2-1]

Organism-specific databases

CTDi58513
DisGeNETi58513
EuPathDBiHostDB:ENSG00000127527.13
GeneCardsiEPS15L1
HGNCiHGNC:24634 EPS15L1
HPAiHPA019237
HPA055309
MalaCardsiEPS15L1
neXtProtiNX_Q9UBC2
OpenTargetsiENSG00000127527
Orphaneti2440 Isolated split hand-split foot malformation
PharmGKBiPA134906266
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0998 Eukaryota
ENOG410XTDR LUCA
GeneTreeiENSGT00760000118985
HOGENOMiHOG000004804
HOVERGENiHBG005591
InParanoidiQ9UBC2
KOiK12472
OMAiQELHTDP
OrthoDBiEOG091G01RG
PhylomeDBiQ9UBC2
TreeFamiTF324293

Enzyme and pathway databases

ReactomeiR-HSA-182971 EGFR downregulation
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRSiEPS15L1 human
GeneWikiiEPS15L1
GenomeRNAii58513
PROiPR:Q9UBC2

Gene expression databases

BgeeiENSG00000127527 Expressed in 196 organ(s), highest expression level in gastrocnemius
CleanExiHS_EPS15L1
ExpressionAtlasiQ9UBC2 baseline and differential
GenevisibleiQ9UBC2 HS

Family and domain databases

CDDicd00052 EH, 3 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom
PfamiView protein in Pfam
PF12763 EF-hand_4, 3 hits
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SM00027 EH, 3 hits
SUPFAMiSSF47473 SSF47473, 3 hits
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 4 hits
PS50031 EH, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiEP15R_HUMAN
AccessioniPrimary (citable) accession number: Q9UBC2
Secondary accession number(s): A2RRF3, A5PL29, B4DKA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 165 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again