Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (26 Feb 2020)
Sequence version 2 (05 Oct 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Phosphatidylcholine:ceramide cholinephosphotransferase 1

Gene

sms-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sphingomyelin synthases synthesize the sphingolipid, sphingomyelin, through transfer of the phosphatidyl head group, phosphatidylcholine, on to the primary hydroxyl of ceramide. The reaction is bidirectional depending on the respective levels of the sphingolipid and ceramide.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: sphingolipid metabolism

This protein is involved in the pathway sphingolipid metabolism, which is part of Lipid metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway sphingolipid metabolism and in Lipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei336By similarity1
Active sitei379By similarity1
Active sitei383By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processLipid metabolism, Sphingolipid metabolism

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.8.27 1045

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-1660661 Sphingolipid de novo biosynthesis

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00222

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000013

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylcholine:ceramide cholinephosphotransferase 1 (EC:2.7.8.27)
Alternative name(s):
Sphingomyelin synthase 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:sms-1
ORF Names:H21P03.3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome IV

Organism-specific databases

WormBase

More...
WormBasei
H21P03.3a ; CE44486 ; WBGene00004892 ; sms-1
H21P03.3b ; CE44496 ; WBGene00004892 ; sms-1
H21P03.3c ; CE44516 ; WBGene00004892 ; sms-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei186 – 206HelicalSequence analysisAdd BLAST21
Transmembranei231 – 251HelicalSequence analysisAdd BLAST21
Transmembranei262 – 282HelicalSequence analysisAdd BLAST21
Transmembranei300 – 320HelicalSequence analysisAdd BLAST21
Transmembranei327 – 347HelicalSequence analysisAdd BLAST21
Transmembranei355 – 375HelicalSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini376 – 469CytoplasmicSequence analysisAdd BLAST94

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002210741 – 469Phosphatidylcholine:ceramide cholinephosphotransferase 1Add BLAST469

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9U3D4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00004892 Expressed in multi-cellular organism and 4 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
43169, 2 interactors

Database of interacting proteins

More...
DIPi
DIP-25498N

Protein interaction database and analysis system

More...
IntActi
Q9U3D4, 1 interactor

STRING: functional protein association networks

More...
STRINGi
6239.H21P03.3b

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sphingomyelin synthase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3058 Eukaryota
ENOG410XNSC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000170729

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9U3D4

KEGG Orthology (KO)

More...
KOi
K04714

Identification of Orthologs from Complete Genome Data

More...
OMAi
VWWYRLF

Database of Orthologous Groups

More...
OrthoDBi
599210at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9U3D4

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025749 Sphingomyelin_synth-like_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14360 PAP2_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform bCurated (identifier: Q9U3D4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVTVEVADE ETHDVPLVEQ VRTTPDQNVD VKVQENNVVT TKIGPKLETI
60 70 80 90 100
PAAKMQDDNG DEEKAENSEG AAAEKVEKQH DDDGVVVHEE TDGVASSRSS
110 120 130 140 150
HHDKQKPGET KKSGDGKMDD DDIITTARSS SRRICGSAAS SSDSETADDA
160 170 180 190 200
PLLPDEGPSH AVRLEMPGDK PASPHDRFPK TPLKTLVAFL MLVVAAAGNT
210 220 230 240 250
ITLSWIHERY PLTPPLPDIV FELIPKIPWG LRLCENLMIG SFVSLLVLIL
260 270 280 290 300
FHRHRWIVLR RLCFIGSILY GMRCITMMVT PVPKADEDFE CSPRFGENAT
310 320 330 340 350
FSLIVMRGVW SMFGLGLNLF DNQKVVLCGD YIYSGHTLVL VVSALFIGEY
360 370 380 390 400
SPRRFYILHW LSWLVCSVGV IFLVLSHGHY TIDVILSYFA CTRVFWAYHT
410 420 430 440 450
QAAHPSIRLS VQNHQAKEFW FPLLRWFEGD IRRPVPRRFD CPISYSQVCN
460
AFRRVRPRGR NGAARPAFE
Length:469
Mass (Da):52,642
Last modified:October 5, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i62BBE972FC8D1911
GO
Isoform aCurated (identifier: Q9U3D4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MSVTVEVADEETHDVPLVEQVRTTPDQNVDVKVQENNVVTTKIGPKLETIPAAKMQ → MKMSWNHQYTNYGSIA

Show »
Length:429
Mass (Da):48,400
Checksum:i50D2AB883B5D39AD
GO
Isoform c (identifier: Q9U3D4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-117: Missing.

Show »
Length:352
Mass (Da):40,003
Checksum:iD1A0AFB356142E59
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H2L2K5H2L2K5_CAEEL
PAP2_C domain-containing protein
sms-1 CELE_H21P03.3, H21P03.3
415Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0398071 – 117Missing in isoform c. CuratedAdd BLAST117
Alternative sequenceiVSP_0506741 – 56MSVTV…AAKMQ → MKMSWNHQYTNYGSIA in isoform a. CuratedAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z95619 Genomic DNA Translation: CAB09114.2
Z95619 Genomic DNA Translation: CAB54269.2
Z95619 Genomic DNA Translation: CAQ58114.2

Protein sequence database of the Protein Information Resource

More...
PIRi
T23111
T23112

NCBI Reference Sequences

More...
RefSeqi
NP_001129861.2, NM_001136389.2 [Q9U3D4-3]
NP_502168.2, NM_069767.2 [Q9U3D4-1]
NP_502169.2, NM_069768.4 [Q9U3D4-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
H21P03.3a.1; H21P03.3a.1; WBGene00004892 [Q9U3D4-2]
H21P03.3b.1; H21P03.3b.1; WBGene00004892 [Q9U3D4-1]
H21P03.3c.1; H21P03.3c.1; WBGene00004892 [Q9U3D4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
178072

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_H21P03.3

UCSC genome browser

More...
UCSCi
H21P03.3a c. elegans [Q9U3D4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z95619 Genomic DNA Translation: CAB09114.2
Z95619 Genomic DNA Translation: CAB54269.2
Z95619 Genomic DNA Translation: CAQ58114.2
PIRiT23111
T23112
RefSeqiNP_001129861.2, NM_001136389.2 [Q9U3D4-3]
NP_502168.2, NM_069767.2 [Q9U3D4-1]
NP_502169.2, NM_069768.4 [Q9U3D4-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi43169, 2 interactors
DIPiDIP-25498N
IntActiQ9U3D4, 1 interactor
STRINGi6239.H21P03.3b

Chemistry databases

SwissLipidsiSLP:000000013

Proteomic databases

PaxDbiQ9U3D4

Genome annotation databases

EnsemblMetazoaiH21P03.3a.1; H21P03.3a.1; WBGene00004892 [Q9U3D4-2]
H21P03.3b.1; H21P03.3b.1; WBGene00004892 [Q9U3D4-1]
H21P03.3c.1; H21P03.3c.1; WBGene00004892 [Q9U3D4-3]
GeneIDi178072
KEGGicel:CELE_H21P03.3
UCSCiH21P03.3a c. elegans [Q9U3D4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
178072
WormBaseiH21P03.3a ; CE44486 ; WBGene00004892 ; sms-1
H21P03.3b ; CE44496 ; WBGene00004892 ; sms-1
H21P03.3c ; CE44516 ; WBGene00004892 ; sms-1

Phylogenomic databases

eggNOGiKOG3058 Eukaryota
ENOG410XNSC LUCA
GeneTreeiENSGT00940000170729
InParanoidiQ9U3D4
KOiK04714
OMAiVWWYRLF
OrthoDBi599210at2759
PhylomeDBiQ9U3D4

Enzyme and pathway databases

UniPathwayiUPA00222
BRENDAi2.7.8.27 1045
ReactomeiR-CEL-1660661 Sphingolipid de novo biosynthesis

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9U3D4

Gene expression databases

BgeeiWBGene00004892 Expressed in multi-cellular organism and 4 other tissues

Family and domain databases

InterProiView protein in InterPro
IPR025749 Sphingomyelin_synth-like_dom
PfamiView protein in Pfam
PF14360 PAP2_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSMS1_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9U3D4
Secondary accession number(s): B3GWD9, Q9XTV2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: October 5, 2010
Last modified: February 26, 2020
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again