Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (08 May 2019)
Sequence version 2 (01 Jun 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Defective in cullin neddylation protein 1

Gene

dcn-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with rbx-1 to recruit the Nedd8-charged E2 enzyme to the cullin component of SCF-type complexes.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-8951664 Neddylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Defective in cullin neddylation protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:dcn-1
ORF Names:H38K22.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome III

Organism-specific databases

WormBase

More...
WormBasei
H38K22.2a ; CE33527 ; WBGene00010428 ; dcn-1
H38K22.2b ; CE33528 ; WBGene00010428 ; dcn-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001295071 – 295Defective in cullin neddylation protein 1Add BLAST295

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9U3C8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9U3C8

PeptideAtlas

More...
PeptideAtlasi
Q9U3C8

PRoteomics IDEntifications database

More...
PRIDEi
Q9U3C8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00010428 Expressed in 5 organ(s), highest expression level in multi-cellular organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the cullin cul-3.

Interacts with ubiquitin via its UBA-like domain.

Interacts with ned-8/nedd8.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
40792, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q9U3C8, 2 interactors

STRING: functional protein association networks

More...
STRINGi
6239.H38K22.2a

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9U3C8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 45UBA-likeAdd BLAST38
Domaini60 – 272DCUN1PROSITE-ProRule annotationAdd BLAST213

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3077 Eukaryota
ENOG410XTIJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000168836

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000241761

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9U3C8

KEGG Orthology (KO)

More...
KOi
K17822

Identification of Orthologs from Complete Genome Data

More...
OMAi
FWNEDGA

Database of Orthologous Groups

More...
OrthoDBi
1418097at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9U3C8

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014764 DCN-prot
IPR005176 PONY_dom
IPR009060 UBA-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12281 PTHR12281, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03556 Cullin_binding, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934 SSF46934, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51229 DCUN1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: Q9U3C8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRLKSDQKT KLRQFVQWTQ VTEAVSLNFL AKANWNIEYA MTLYFDNPNL
60 70 80 90 100
FAGSTPQPSV DRSNIERLFN QYVDPKDKVG EKRMGPHGIN RLLTDLGYEA
110 120 130 140 150
TDRRVLVLAW KFTAQTQCEF SLDEWVKGMT ALQADTVQNL RQRIDSINSG
160 170 180 190 200
LESDKAKFHE LYLFAFNYAK SAACRNLDLE TAICCWDVLF GQRSTIMTQW
210 220 230 240 250
IDFLWAQENA AASRLAQNVG ASNAKQFKSV WISRDTWNLF WDFILLSKPD
260 270 280 290
LSDYDDEGAW PVLIDQFVDY CRENLNYPKP GNASNDQQME TPSYY
Length:295
Mass (Da):34,133
Last modified:June 1, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF5C50912727235E4
GO
Isoform b (identifier: Q9U3C8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MNRLKSDQKTKLRQFVQWTQVTEAVSLNFLAKANWNIEYAMTLYFDNPNLFAGSTPQPSVDRSN → MNRLKSDQKTK

Show »
Length:242
Mass (Da):28,057
Checksum:i7DE0D1CD5BB964F1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0153191 – 64MNRLK…VDRSN → MNRLKSDQKTK in isoform b. CuratedAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL024499 Genomic DNA Translation: CAB54261.2
AL024499 Genomic DNA Translation: CAB54260.2

Protein sequence database of the Protein Information Resource

More...
PIRi
T23140
T23141

NCBI Reference Sequences

More...
RefSeqi
NP_497866.2, NM_065465.5 [Q9U3C8-1]
NP_497867.2, NM_065466.5 [Q9U3C8-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
H38K22.2a; H38K22.2a; WBGene00010428 [Q9U3C8-1]
H38K22.2b; H38K22.2b; WBGene00010428 [Q9U3C8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
175556

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_H38K22.2

UCSC genome browser

More...
UCSCi
H38K22.2a c. elegans [Q9U3C8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL024499 Genomic DNA Translation: CAB54261.2
AL024499 Genomic DNA Translation: CAB54260.2
PIRiT23140
T23141
RefSeqiNP_497866.2, NM_065465.5 [Q9U3C8-1]
NP_497867.2, NM_065466.5 [Q9U3C8-2]

3D structure databases

SMRiQ9U3C8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi40792, 9 interactors
IntActiQ9U3C8, 2 interactors
STRINGi6239.H38K22.2a

Proteomic databases

EPDiQ9U3C8
PaxDbiQ9U3C8
PeptideAtlasiQ9U3C8
PRIDEiQ9U3C8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiH38K22.2a; H38K22.2a; WBGene00010428 [Q9U3C8-1]
H38K22.2b; H38K22.2b; WBGene00010428 [Q9U3C8-2]
GeneIDi175556
KEGGicel:CELE_H38K22.2
UCSCiH38K22.2a c. elegans [Q9U3C8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
175556
WormBaseiH38K22.2a ; CE33527 ; WBGene00010428 ; dcn-1
H38K22.2b ; CE33528 ; WBGene00010428 ; dcn-1

Phylogenomic databases

eggNOGiKOG3077 Eukaryota
ENOG410XTIJ LUCA
GeneTreeiENSGT00940000168836
HOGENOMiHOG000241761
InParanoidiQ9U3C8
KOiK17822
OMAiFWNEDGA
OrthoDBi1418097at2759
PhylomeDBiQ9U3C8

Enzyme and pathway databases

ReactomeiR-CEL-8951664 Neddylation

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9U3C8

Gene expression databases

BgeeiWBGene00010428 Expressed in 5 organ(s), highest expression level in multi-cellular organism

Family and domain databases

InterProiView protein in InterPro
IPR014764 DCN-prot
IPR005176 PONY_dom
IPR009060 UBA-like_sf
PANTHERiPTHR12281 PTHR12281, 1 hit
PfamiView protein in Pfam
PF03556 Cullin_binding, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
PROSITEiView protein in PROSITE
PS51229 DCUN1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDCN1_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9U3C8
Secondary accession number(s): Q9U3C9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: June 1, 2003
Last modified: May 8, 2019
This is version 128 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again