Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein spire

Gene

spir

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as an actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Promotes dissociation of capu from the barbed end of actin filaments. Involved in intracellular vesicle transport along actin fibers, providing a novel link between actin cytoskeleton dynamics and intracellular transport. Required for localization of determinants within the developing oocyte to the posterior pole and to the dorsal anterior corner. Links Rho family signaling and Jnk function to the actin cytoskeleton.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: FlyBase
  • microtubule binding Source: FlyBase

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Developmental protein
Biological processProtein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein spire
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:spirImported
Synonyms:p150-SpirImported
ORF Names:CG10076
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0003475 spir

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Flies display premature microtubule-dependent cytoplasmic streaming; failure in the orientation of microtubule plus ends towards the posterior pole.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi232Y → K: Abolishes interaction with capu. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003095731 – 1020Protein spireAdd BLAST1020

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by Jnk kinase (bsk).1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9U1K1

PRoteomics IDEntifications database

More...
PRIDEi
Q9U1K1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed both maternally and zygotically.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0003475 Expressed in 55 organ(s), highest expression level in egg chamber

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9U1K1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9U1K1 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with bsk, Rho1, Rac1, Cdc42 and wash. Interacts with capu.6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
69994, 20 interactors

Database of interacting proteins

More...
DIPi
DIP-17301N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9U1K1

Protein interaction database and analysis system

More...
IntActi
Q9U1K1, 13 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0080884

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11020
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3MMVX-ray2.80X429-447[»]
3MN5X-ray1.50S448-485[»]
3MN6X-ray2.00X/Y/Z397-415[»]
3MN7X-ray2.00S441-479[»]
3MN9X-ray2.00X372-390[»]
3UE5X-ray2.76B428-485[»]
4EFHX-ray2.48B428-485[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9U1K1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9U1K1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9U1K1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini90 – 327KINDPROSITE-ProRule annotationAdd BLAST238
Domaini399 – 417WH2 1PROSITE-ProRule annotationAdd BLAST19
Domaini463 – 480WH2 2PROSITE-ProRule annotationAdd BLAST18

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni705 – 725Spir-boxAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi205 – 220His-richSequence analysisAdd BLAST16
Compositional biasi792 – 877Ser-richSequence analysisAdd BLAST86

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binds to actin monomers via the WH2 domain.1 Publication
The Spir-box targets binding to intracellular membrane structures.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the spire family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IK9H Eukaryota
ENOG4111E0J LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003058

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9U1K1

KEGG Orthology (KO)

More...
KOi
K02098

Identification of Orthologs from Complete Genome Data

More...
OMAi
EECQMSQ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9U1K1

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011019 KIND_dom
IPR029901 Spire
IPR029905 Spire1
IPR003124 WH2_dom
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD

The PANTHER Classification System

More...
PANTHERi
PTHR21345 PTHR21345, 1 hit
PTHR21345:SF3 PTHR21345:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16474 KIND, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00750 KIND, 1 hit
SM00246 WH2, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51377 KIND, 1 hit
PS51082 WH2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform A1 Publication (identifier: Q9U1K1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTEHQAEEQA DTPPTKVKAT PTPTPSGKFK DAKEDAFLST SPDSANGDAQ
60 70 80 90 100
HKLPADQLAM SSSAHPQQAG QARPLILQAF HRCSSPEQCV TLHDILDSFK
110 120 130 140 150
APLSEDQAWA LIHQFAGLYH QVAVQAHTCA ADYEAALPTG FELHFHRDGS
160 170 180 190 200
VHFSGPDQLT PKEQLQQEQI PLPPQHDVIV DQPDHSASSS GDSSVINRAF
210 220 230 240 250
DNSNHHHHHQ HHHPPLVVSH RKIISELAEI VYTALDYNLP EDEECQVSQE
260 270 280 290 300
LENLFNFMTA DETDDDCIDE GIDEGDKRWD DESEEERNDT KELEHIIETC
310 320 330 340 350
RNHIKTTLPE NHYRAVCRAL VTETIELRVF LQQVLNNEAG AEKLIKASES
360 370 380 390 400
SATTQQELAK LGFNDWARFW VQVIDELRRG VRLKKSNHER TPIEYELTPY
410 420 430 440 450
EILMGDIRAK KYQLRKVMVN GDIPPRVKKD AHAMILEFIR SRPPLKKASD
460 470 480 490 500
RQLGPPRMCE PSPREQLMES IRKGKELKQI TPPEAPTLRE RVLPSANSTL
510 520 530 540 550
SRSRQRLIKV DFSKFQDDDL FYDENSISSS HSTAATHQHH PHFAEMHRCS
560 570 580 590 600
QPKMPPYPFG GYMVPSQARQ DCRETASLMR PRRTMEPAKQ VPPPEEPSFT
610 620 630 640 650
KDEYHKFYDT ALESYDLATQ CESRRASLRR HTIVGCQSNL DETHSMPPTR
660 670 680 690 700
PESRQSDDVS KETPKRSPAE QTHPSDEGSS TSSLGPWNKS FMDKQTWMER
710 720 730 740 750
GDDRLSVTLA EIVHIRSVMT KAELEGLPMD VRVKEDVEKR RVCFLCLRTR
760 770 780 790 800
FSFFGPWGIQ CKLCQRTVCA KCYTKMRIPS EHFRNVPLVL ISPSLLSSPA
810 820 830 840 850
SSSTPSPSHH AQQAHSSSTG NIMDDQFPKS LIERLLRSES DRKTRSTVGS
860 870 880 890 900
APSSPKHQRS NMSTPGISVG PGASSSSAAA TGQAVEALHD QATMSSSYSA
910 920 930 940 950
AMRPSGVHQQ QKQHYNNAMS RSMEGPRSLP VHSPAYRPLS NNSTLERKSR
960 970 980 990 1000
FSRGFNLFSS GSHLAQTQEQ KENLRGEQVT VCNDCQGLVN EITSSVKQKR
1010 1020
SSARNRTIQN LTLDLTPVWK
Length:1,020
Mass (Da):114,867
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i010CD024F9ABC078
GO
Isoform B1 Publication (identifier: Q9U1K1-2) [UniParc]FASTAAdd to basket
Also known as: Long1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     585-614: MEPAKQVPPPEEPSFTKDEYHKFYDTALES → T

Show »
Length:991
Mass (Da):111,475
Checksum:i5A39B9F07136E212
GO
Isoform C1 Publication (identifier: Q9U1K1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-96: TEHQAEEQAD...EQCVTLHDIL → EARPAKRSTA...KPRQAIRSSK
     97-491: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:625
Mass (Da):69,401
Checksum:i6B020E5746568D77
GO
Isoform D1 Publication (identifier: Q9U1K1-4) [UniParc]FASTAAdd to basket
Also known as: Short1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     338-338: Missing.
     585-586: ME → SI
     587-1020: Missing.

Show »
Length:585
Mass (Da):66,418
Checksum:i8F2F09E9AB96CF7F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E1JHM3E1JHM3_DROME
Spire, isoform E
spir 38C.34, 38C.37, CG18621, Dmel\CG10076, l(2)08327
990Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NDT9M9NDT9_DROME
Spire, isoform F
spir 38C.34, 38C.37, CG18621, Dmel\CG10076, l(2)08327
1,018Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X2J709X2J709_DROME
Spire, isoform I
spir 38C.34, 38C.37, CG18621, Dmel\CG10076, l(2)08327
498Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NCY7M9NCY7_DROME
Spire, isoform H
spir 38C.34, 38C.37, CG18621, Dmel\CG10076, l(2)08327
488Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NFB6M9NFB6_DROME
Spire, isoform G
spir 38C.34, 38C.37, CG18621, Dmel\CG10076, l(2)08327
586Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53L → M in AAF23615 (PubMed:10556052).Curated1
Sequence conflicti53L → M in AAF23616 (PubMed:10556052).Curated1
Sequence conflicti885V → A in AAF23615 (PubMed:10556052).Curated1

<p>This subsection of the ‘Sequence’ section provides information relevant to all types of RNA editing events (conversion, insertion, deletion of nucleotides) that lead to one or more amino acid changes compared to the translation of the non-edited RNA version.<p><a href='/help/rna_editing' target='_top'>More...</a></p>RNA editingi

Edited at position 734.2 Publications
Partially edited. Target of Adar.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti734K → R in RNA edited version. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0525992 – 96TEHQA…LHDIL → EARPAKRSTAASVFRSHHMP RESDLVDIGSDASLYCGSDG ESSQAQSTSTSTPNPQTSSD QDLDQPQPTPRAAPRASASN NPPTPKPRQAIRSSK in isoform C. 2 PublicationsAdd BLAST95
Alternative sequenceiVSP_05260097 – 491Missing in isoform C. 2 PublicationsAdd BLAST395
Alternative sequenceiVSP_052601338Missing in isoform D. 2 Publications1
Alternative sequenceiVSP_052602585 – 614MEPAK…TALES → T in isoform B. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_052603585 – 586ME → SI in isoform D. 2 Publications2
Alternative sequenceiVSP_052604587 – 1020Missing in isoform D. 2 PublicationsAdd BLAST434

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF184975 mRNA Translation: AAF23615.1
AF184976 mRNA Translation: AAF23616.1
AJ238876 mRNA Translation: CAB62901.1
AE014134 Genomic DNA Translation: AAF53884.2
AE014134 Genomic DNA Translation: AAN11070.1
AE014134 Genomic DNA Translation: AAN11071.1
AE014134 Genomic DNA Translation: AAN11072.2
AY075586 mRNA Translation: AAL68390.1
AY089503 mRNA Translation: AAL90241.1
BT016094 mRNA Translation: AAV36979.1

NCBI Reference Sequences

More...
RefSeqi
NP_001246102.1, NM_001259173.1
NP_001286100.1, NM_001299171.1
NP_524854.2, NM_080115.3 [Q9U1K1-2]
NP_724254.1, NM_165323.3 [Q9U1K1-1]
NP_724255.1, NM_165324.2 [Q9U1K1-4]
NP_724256.2, NM_165325.3 [Q9U1K1-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Dm.3356

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0081352; FBpp0080884; FBgn0003475 [Q9U1K1-1]
FBtr0081353; FBpp0080885; FBgn0003475 [Q9U1K1-2]
FBtr0081354; FBpp0080886; FBgn0003475 [Q9U1K1-4]
FBtr0081355; FBpp0080887; FBgn0003475 [Q9U1K1-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
45931

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG10076

UCSC genome browser

More...
UCSCi
CG10076-RA d. melanogaster [Q9U1K1-1]

Keywords - Coding sequence diversityi

Alternative splicing, RNA editing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF184975 mRNA Translation: AAF23615.1
AF184976 mRNA Translation: AAF23616.1
AJ238876 mRNA Translation: CAB62901.1
AE014134 Genomic DNA Translation: AAF53884.2
AE014134 Genomic DNA Translation: AAN11070.1
AE014134 Genomic DNA Translation: AAN11071.1
AE014134 Genomic DNA Translation: AAN11072.2
AY075586 mRNA Translation: AAL68390.1
AY089503 mRNA Translation: AAL90241.1
BT016094 mRNA Translation: AAV36979.1
RefSeqiNP_001246102.1, NM_001259173.1
NP_001286100.1, NM_001299171.1
NP_524854.2, NM_080115.3 [Q9U1K1-2]
NP_724254.1, NM_165323.3 [Q9U1K1-1]
NP_724255.1, NM_165324.2 [Q9U1K1-4]
NP_724256.2, NM_165325.3 [Q9U1K1-3]
UniGeneiDm.3356

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3MMVX-ray2.80X429-447[»]
3MN5X-ray1.50S448-485[»]
3MN6X-ray2.00X/Y/Z397-415[»]
3MN7X-ray2.00S441-479[»]
3MN9X-ray2.00X372-390[»]
3UE5X-ray2.76B428-485[»]
4EFHX-ray2.48B428-485[»]
ProteinModelPortaliQ9U1K1
SMRiQ9U1K1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi69994, 20 interactors
DIPiDIP-17301N
ELMiQ9U1K1
IntActiQ9U1K1, 13 interactors
STRINGi7227.FBpp0080884

Proteomic databases

PaxDbiQ9U1K1
PRIDEiQ9U1K1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0081352; FBpp0080884; FBgn0003475 [Q9U1K1-1]
FBtr0081353; FBpp0080885; FBgn0003475 [Q9U1K1-2]
FBtr0081354; FBpp0080886; FBgn0003475 [Q9U1K1-4]
FBtr0081355; FBpp0080887; FBgn0003475 [Q9U1K1-3]
GeneIDi45931
KEGGidme:Dmel_CG10076
UCSCiCG10076-RA d. melanogaster [Q9U1K1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
45931
FlyBaseiFBgn0003475 spir

Phylogenomic databases

eggNOGiENOG410IK9H Eukaryota
ENOG4111E0J LUCA
GeneTreeiENSGT00390000003058
InParanoidiQ9U1K1
KOiK02098
OMAiEECQMSQ
PhylomeDBiQ9U1K1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
spir fly
EvolutionaryTraceiQ9U1K1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
45931

Protein Ontology

More...
PROi
PR:Q9U1K1

Gene expression databases

BgeeiFBgn0003475 Expressed in 55 organ(s), highest expression level in egg chamber
ExpressionAtlasiQ9U1K1 baseline and differential
GenevisibleiQ9U1K1 DM

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR011019 KIND_dom
IPR029901 Spire
IPR029905 Spire1
IPR003124 WH2_dom
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR21345 PTHR21345, 1 hit
PTHR21345:SF3 PTHR21345:SF3, 1 hit
PfamiView protein in Pfam
PF16474 KIND, 2 hits
SMARTiView protein in SMART
SM00750 KIND, 1 hit
SM00246 WH2, 2 hits
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS51377 KIND, 1 hit
PS51082 WH2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPIR_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9U1K1
Secondary accession number(s): Q5U0Z8
, Q8INV3, Q8INV4, Q8INV5, Q8SXP3, Q8T8P8, Q9U4F0, Q9U4F1, Q9VIN3, Q9VIN4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: May 1, 2000
Last modified: January 16, 2019
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again