Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (12 Aug 2020)
Sequence version 2 (01 Oct 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Dystrophin-1

Gene

dys-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in cholinergic transmission and as a functional partner of dystrobrevin (dyb-1), necessary for muscle maintenance. Required for neuronal positioning.5 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri3300 – 3347ZZ-typePROSITE-ProRule annotationAdd BLAST48

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
LigandCalcium, Metal-binding, Zinc

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.A.66.1.1, the dystrophin (dystrophin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dystrophin-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:dys-1
ORF Names:F15D3.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome I

Organism-specific databases

WormBase

More...
WormBasei
F15D3.1a ; CE27129 ; WBGene00001131 ; dys-1
F15D3.1b ; CE24904 ; WBGene00001131 ; dys-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutants display a phenotype of hyperactive locomotion and are hypersensitive to the acetylcholinesterase inhibitor aldicarb and are defective in maintaining neuronal positioning. Dys-1 and hlh-1 double mutants synergistically exhibit progressive myopathy.4 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000760791 – 3674Dystrophin-1Add BLAST3674

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9TW65

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9TW65

PeptideAtlas

More...
PeptideAtlasi
Q9TW65

PRoteomics IDEntifications database

More...
PRIDEi
Q9TW65

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9TW65

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in body wall, head, pharyngeal and vulval muscles, from late embryogenesis to adulthood (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00001131, Expressed in multi-cellular organism and 5 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9TW65, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the dystrophin glycoprotein complex (DGC).

Interacts with dyb-1 and stn-1 to form the DGC.

Interacts with stn-2.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
38445, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9TW65, 3 interactors

STRING: functional protein association networks

More...
STRINGi
6239.F15D3.1a

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9TW65

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini129 – 234Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST106
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati327 – 435Spectrin 1Add BLAST109
Repeati436 – 541Spectrin 2Add BLAST106
Repeati612 – 656Spectrin 3Add BLAST45
Repeati2576 – 2673Spectrin 4Add BLAST98
Repeati2725 – 2789Spectrin 5Add BLAST65
Repeati2792 – 2905Spectrin 6Add BLAST114
Repeati2926 – 3032Spectrin 7Add BLAST107
Domaini3047 – 3081WWPROSITE-ProRule annotationAdd BLAST35

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni30 – 39Actin-binding10

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri3300 – 3347ZZ-typePROSITE-ProRule annotationAdd BLAST48

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4286, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000246_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9TW65

Identification of Orthologs from Complete Genome Data

More...
OMAi
KARIHQQ

Database of Orthologous Groups

More...
OrthoDBi
629209at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9TW65

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014, CH, 1 hit
cd00201, WW, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit
3.30.60.90, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001589, Actinin_actin-bd_CS
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR011992, EF-hand-dom_pair
IPR015153, EF-hand_dom_typ1
IPR015154, EF-hand_dom_typ2
IPR018159, Spectrin/alpha-actinin
IPR002017, Spectrin_repeat
IPR001202, WW_dom
IPR036020, WW_dom_sf
IPR013087, Znf_C2H2_type
IPR000433, Znf_ZZ
IPR043145, Znf_ZZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307, CH, 1 hit
PF09068, EF-hand_2, 1 hit
PF09069, EF-hand_3, 1 hit
PF00435, Spectrin, 2 hits
PF00569, ZZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033, CH, 1 hit
SM00150, SPEC, 7 hits
SM00456, WW, 1 hit
SM00291, ZnF_ZZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 2 hits
SSF47576, SSF47576, 1 hit
SSF51045, SSF51045, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00019, ACTININ_1, 1 hit
PS50021, CH, 1 hit
PS01159, WW_DOMAIN_1, 1 hit
PS50020, WW_DOMAIN_2, 1 hit
PS50135, ZF_ZZ_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform a (identifier: Q9TW65-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLFSGASTAK PKKDEKKDKK SDRDPKNELQ EWVFVRWANH LLGTERLTDY
60 70 80 90 100
KSLQDGSNAI FVYQAIIGQT MAVLGNPSDD WPNVLQNIGD SKTNPQEVME
110 120 130 140 150
GQQKAVLSAW WQLVQFFWKN NAPVQLREEK LSEAIKQWCI EVMKSYEEID
160 170 180 190 200
VYDFTSSFRD GHAFNYLIHS YDRKLINLTK TAEMSAIDRI ENAFAVAEKT
210 220 230 240 250
WNVPRLLNPK DLHSDQLDSH SVLCYLMSLY LAMISTSKIE TELEAQQIQQ
260 270 280 290 300
QKVAALLASH KMLSSQPSTS SSSALQIPPQ TPPTAHHQAM LDRGKSFEQS
310 320 330 340 350
AEGEVRSRKS SSSSQKSGKS KKARREEQLA EFKSCIEQVL TWLLEAEDEL
360 370 380 390 400
TTLTQMPRVE LASVRSQFSD FESFMSSLTD SQDTVGRVLL RGQMLSNKSE
410 420 430 440 450
SEEEKESIGA NLHLVNTRWE ALREQAMQEQ AVLQQQIHLL QQSELDTISQ
460 470 480 490 500
WLDAAELEIE SFGPLAADSS QALRQIELHT KFQQKLNDFQ ETIDKLESFV
510 520 530 540 550
AVVDEENDAS VATLEDALSA VSVRWGHVCE WAEKRATKLD GLADLLDKTN
560 570 580 590 600
EVFENLSGWL AERENELMTG LKSAHHLENE EQVAQQVRRL QKTEEQLEQE
610 620 630 640 650
HASFVRLSQL SCELVGRLDD SNGAAANAVR LSLDSITQRW DNLVARIEEH
660 670 680 690 700
GKTLVKSGKA DVKQVQESQN EQKEQPASSE GLSTDTEGEE QKNQLVDKFL
710 720 730 740 750
LHISKLSHEL EPLQDWSEKF EVSRKKDDIR KMMNTCQEKL IQIKEQEARV
760 770 780 790 800
NRLQLELEHL HVAKLNARQL KRANDAFEQF AKGWARIVTK ISEAMNVLTG
810 820 830 840 850
QEAGGNGNGS EEAAVAAKIE QWIEAVDKVI NELSQLPVNE RRSRIDKLEQ
860 870 880 890 900
QLQVQDKNVG FIEKDLLKKA ILKKGLEIAG KRLAALKVEE KPVEKEEQLV
910 920 930 940 950
LSNSEEPEAE KHVTFVQETT EKPAPLQEPT SEAQLLEELD GPWSRVGDVV
960 970 980 990 1000
AIEHDLLRAK RAVDTARNSQ MSNETVEKAE TRKAEMEEKR RVTMSARSKF
1010 1020 1030 1040 1050
RMAEETLEEI ERNLDRLQVS DLEIADLVRG LEQEAAKLGE RVSQRKEAER
1060 1070 1080 1090 1100
TAEKILSMDD DEISQEIVIK TKDSTEKLIK RWNQLELDLE ENLRKAKRDQ
1110 1120 1130 1140 1150
DVFIQKRLRE GEEALNEIKT AIEGKRESLD AETAAENLDH LESSLDNISS
1160 1170 1180 1190 1200
LFGEIGSLPM DDNSREKLSK LAKAKDQITA RANEALAALT RTVSECEDFE
1210 1220 1230 1240 1250
KQIMLFQNWS ARIGFLLQAR KSADISAFDI PHEYHEDLGN EAELIPKLSR
1260 1270 1280 1290 1300
EFEEWTVKLN EMNSTATEKD DSARMREQLN HANETMAELK RKFNEFKRPK
1310 1320 1330 1340 1350
GFEEKLEKVI TTLSNVEMGL DDTTGIDGSE CGGALMEVRA LVRMLDGAQE
1360 1370 1380 1390 1400
KWKDLAENRE QLVKDRVLDE ETSKETLQKL QYAKTKSKEL YERSSTCIER
1410 1420 1430 1440 1450
LEDCVEMYQR LKMESDEIER FLEEMEGKLD QYAASDRPEE AEIVNELISE
1460 1470 1480 1490 1500
WNRNEAAMKN AEHLQRQLNE RAIKIPDDVL SLKRLRADAL KNRLNSWCRT
1510 1520 1530 1540 1550
IQEMSEDDES ALLEIDELHQ NLEKELKLVS DKEPSKIAEK LRFLRADRDR
1560 1570 1580 1590 1600
LSSRTRKLAA KNPRLAATSS DVLAGLNQKW KELEVKASAE KAPAPELRDA
1610 1620 1630 1640 1650
RLSSPSEQPF DKRVQELCDL FENLEAQLDF NGSPVSMVTE YQKRVENLDE
1660 1670 1680 1690 1700
YLDEYRPALD DTIEEGRKIA ETGRLELQTH SAIEKLDELT NRIEQVEVEL
1710 1720 1730 1740 1750
DKHRDKVPSL VEQHEQLKKD IDSFLLVLDV FTDRNLDDVD IAKSTRKELA
1760 1770 1780 1790 1800
ERDSHIVSLT SRATAIHCAL PGKGPQLHDV TLDKLRDRIE KLEARLSATE
1810 1820 1830 1840 1850
KKPVETVKST IPDRPEVPEE PEKSSPDRTS RSSLQLAMEA YGTATEDDSV
1860 1870 1880 1890 1900
ISEAVTVGQK SVDQVDPVEQ LEPVEPVEPK LEVKQLKDEA TEEEEKRTII
1910 1920 1930 1940 1950
LPDETEKVIE TIPAARPSAG PSEGTVAEVS TSEILKARPA QESIERTVRE
1960 1970 1980 1990 2000
VPVDEYEETA NISSGDELQD HKISSAVPDS ESEIASMFEV LDSIEDSHTN
2010 2020 2030 2040 2050
FEEFPFDYLD SADDDLKKTL LKLESCEKTL AKNEMTINIA QAENARERIT
2060 2070 2080 2090 2100
MLRQMALQRK DKLPKFNEEW NAMQELIQLA DALVDEAERY ESDQIPQMDR
2110 2120 2130 2140 2150
KSAPNVLGEL RKRVANAEGP VIDLVKKLSQ LVPRMQEDSP KSQDIRQKVY
2160 2170 2180 2190 2200
GIEDRFRRVG QAEGAAISKA LSSALTEPEL KLELDEVVRW CEMAEKEAAQ
2210 2220 2230 2240 2250
NVNSLDGDGL EKLDGRLAQF TKELQERKDD MVQLEMAKNM IIPSLKGDAH
2260 2270 2280 2290 2300
HDLRRNFSDT AKRVAMVRDE LSDAHKWVAT SRDTCDTFWA DIDSLEQLAR
2310 2320 2330 2340 2350
DVVRRANGIR MAVIYTPSRE NVEGVLRDVQ RLKMSIGDVK KRVQTANLPP
2360 2370 2380 2390 2400
AIKLAGKNAK RVVQVLTETA TTIADCHDIP TYLIDEMNDS GGDTTESRST
2410 2420 2430 2440 2450
VVEMTSVHTK QSSSSSSNKT PSAGGESDDA HTLNGDDEQS EEDQKIYSRE
2460 2470 2480 2490 2500
SSSTLPRGVS SLGSTGSSGV LDPVAVQLTH TRHWLHDVER DASITVDLAQ
2510 2520 2530 2540 2550
WQPARELWQS IQGIIDEIRL RSVHVTGAHD ASPNRQVRQQ AAQLLTEMRR
2560 2570 2580 2590 2600
TIENCEKRCL ILNQISDIAR QNEASRNEME LWLKSASDVI GERRVEELSE
2610 2620 2630 2640 2650
EVVRQELQVL ERVVEQLTER KDKMAEINSQ ANKIVDTYTK DEAHNLSHLL
2660 2670 2680 2690 2700
SRLNMSWTKF NDNIRIRRAV LEASLRSRRD FHSALSEFEK WLSRQEDNCS
2710 2720 2730 2740 2750
KLSADTSNHQ AIKDTSKRKN WTQSFKTLNA ELNAHEDVMK SVEKMGKMLA
2760 2770 2780 2790 2800
ESLESGNEKV ELLKRVGETT RRWTALRKTT NEIGERLEKA EQEWEKLSDG
2810 2820 2830 2840 2850
LADLLSWVEA KKQAIMDEQP TGGSLSAVMQ QASFVKGLQR EIESKTANYK
2860 2870 2880 2890 2900
STVEEAHSFL MQHDLRPKLH SPHVLDDDYE KEELANLEQR RRGLEINANC
2910 2920 2930 2940 2950
ERLKKNWAEL GIEVESWDKL VQHAMQRLQE LERNLAECQL HLTSSENEIE
2960 2970 2980 2990 3000
TMKAVEKIHL EDLKIAREET DQISKRIDEV RLFVDDVNDA AARLLAEDLK
3010 3020 3030 3040 3050
LDEHAKGQIE HVNKRYSTLK RAIRIRQAAV RNAASDFGPT SEHFLNQSVT
3060 3070 3080 3090 3100
LPWQRAISKS NLLPYYIEQT SEKTQWEHPV WVEIVKELSQ FNRVKFLAYR
3110 3120 3130 3140 3150
TAMKLRALQK RLCLDLVDLT LLEKAFVRLK GLSAEECPGL EGMVCALLPM
3160 3170 3180 3190 3200
YEALHAKYPN QVQSVSLAVD ICINFLLNLF DQSRDGIMRV LSFKIAMIVF
3210 3220 3230 3240 3250
SNIPLEEKYR YLFKLVSQDG HATQKQIALL LYDLIHIPRL VGESAAFGGT
3260 3270 3280 3290 3300
NVEPSVRSCF ETVRLAPTIS EGAFIDWVKK EPQSIVWLAV MHRLVISEST
3310 3320 3330 3340 3350
KHASKCNVCK MFPIIGIRYR CLTCFNCDLC QNCFFSQRTA KSHRTNHPMQ
3360 3370 3380 3390 3400
EYCEKTTSSD DARDFAKMIR NKFRASKRQK GYLPIDVAEE GIPLTCPPAK
3410 3420 3430 3440 3450
VTNQATEQMN ADTSQMTAHL AKLSAEHGGG AEHMEPVQSP LQIINQVEQL
3460 3470 3480 3490 3500
QRDEMDQMLH RLQFENKQLR KELEWKRGAA STMEIDRSSK RHQERHQSES
3510 3520 3530 3540 3550
RGGTLPLRNG RSVVSLKSTQ SQNDVMDEAK ALRLHKQRLE HRSRILEQQN
3560 3570 3580 3590 3600
EQLEMQLQRL KKVIDAQKQQ APLSTNSLLR GSHHQPWSPE RARSGSASTL
3610 3620 3630 3640 3650
DRGLIVSSRH QEQAEAAGGG AEDSSDEAGG AGGGPRGSSV GQMQNLMTAC
3660 3670
DDLGKAMESL VVSVVYDSDD EEND
Length:3,674
Mass (Da):417,427
Last modified:October 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i793FD9E5A81008FF
GO
Isoform b (identifier: Q9TW65-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3410: Missing.
     3411-3446: ADTSQMTAHLAKLSAEHGGGAEHMEPVQSPLQIINQ → MCSLLKLLKISGKSVSDDDPIERYIKCEQCKCKRHW

Show »
Length:264
Mass (Da):29,727
Checksum:i6543358AC332ED91
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V6CLV8V6CLV8_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
3,663Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CJD7V6CJD7_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
3,448Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CKJ6V6CKJ6_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
2,515Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CLW7V6CLW7_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
1,577Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CLR8V6CLR8_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
3,437Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CJE3V6CJE3_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
2,504Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CIR0V6CIR0_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CL65V6CL65_CAEEL
Dystrophin-1
dys-1 CELE_F15D3.1, F15D3.1
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0516141 – 3410Missing in isoform b. CuratedAdd BLAST3410
Alternative sequenceiVSP_0516153411 – 3446ADTSQ…QIINQ → MCSLLKLLKISGKSVSDDDP IERYIKCEQCKCKRHW in isoform b. CuratedAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ012469 mRNA Translation: CAA10033.1
Z81063, Z81522 Genomic DNA Translation: CAB61012.2
Z81522 Genomic DNA Translation: CAB61004.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T21635

NCBI Reference Sequences

More...
RefSeqi
NP_492946.1, NM_060545.5 [Q9TW65-1]
NP_492947.1, NM_060546.6 [Q9TW65-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
F15D3.1a.1; F15D3.1a.1; WBGene00001131 [Q9TW65-1]
F15D3.1b.1; F15D3.1b.1; WBGene00001131 [Q9TW65-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
173038

UCSC genome browser

More...
UCSCi
F15D3.1b, c. elegans [Q9TW65-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ012469 mRNA Translation: CAA10033.1
Z81063, Z81522 Genomic DNA Translation: CAB61012.2
Z81522 Genomic DNA Translation: CAB61004.1
PIRiT21635
RefSeqiNP_492946.1, NM_060545.5 [Q9TW65-1]
NP_492947.1, NM_060546.6 [Q9TW65-2]

3D structure databases

SMRiQ9TW65
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi38445, 1 interactor
IntActiQ9TW65, 3 interactors
STRINGi6239.F15D3.1a

Protein family/group databases

TCDBi8.A.66.1.1, the dystrophin (dystrophin) family

PTM databases

iPTMnetiQ9TW65

Proteomic databases

EPDiQ9TW65
PaxDbiQ9TW65
PeptideAtlasiQ9TW65
PRIDEiQ9TW65

Genome annotation databases

EnsemblMetazoaiF15D3.1a.1; F15D3.1a.1; WBGene00001131 [Q9TW65-1]
F15D3.1b.1; F15D3.1b.1; WBGene00001131 [Q9TW65-2]
GeneIDi173038
UCSCiF15D3.1b, c. elegans [Q9TW65-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
173038
WormBaseiF15D3.1a ; CE27129 ; WBGene00001131 ; dys-1
F15D3.1b ; CE24904 ; WBGene00001131 ; dys-1

Phylogenomic databases

eggNOGiKOG4286, Eukaryota
HOGENOMiCLU_000246_3_0_1
InParanoidiQ9TW65
OMAiKARIHQQ
OrthoDBi629209at2759
PhylomeDBiQ9TW65

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9TW65

Gene expression databases

BgeeiWBGene00001131, Expressed in multi-cellular organism and 5 other tissues
ExpressionAtlasiQ9TW65, baseline and differential

Family and domain databases

CDDicd00014, CH, 1 hit
cd00201, WW, 1 hit
Gene3Di1.10.418.10, 1 hit
3.30.60.90, 1 hit
InterProiView protein in InterPro
IPR001589, Actinin_actin-bd_CS
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR011992, EF-hand-dom_pair
IPR015153, EF-hand_dom_typ1
IPR015154, EF-hand_dom_typ2
IPR018159, Spectrin/alpha-actinin
IPR002017, Spectrin_repeat
IPR001202, WW_dom
IPR036020, WW_dom_sf
IPR013087, Znf_C2H2_type
IPR000433, Znf_ZZ
IPR043145, Znf_ZZ_sf
PfamiView protein in Pfam
PF00307, CH, 1 hit
PF09068, EF-hand_2, 1 hit
PF09069, EF-hand_3, 1 hit
PF00435, Spectrin, 2 hits
PF00569, ZZ, 1 hit
SMARTiView protein in SMART
SM00033, CH, 1 hit
SM00150, SPEC, 7 hits
SM00456, WW, 1 hit
SM00291, ZnF_ZZ, 1 hit
SUPFAMiSSF47473, SSF47473, 2 hits
SSF47576, SSF47576, 1 hit
SSF51045, SSF51045, 1 hit
PROSITEiView protein in PROSITE
PS00019, ACTININ_1, 1 hit
PS50021, CH, 1 hit
PS01159, WW_DOMAIN_1, 1 hit
PS50020, WW_DOMAIN_2, 1 hit
PS50135, ZF_ZZ_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDMD_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9TW65
Secondary accession number(s): Q9TYG9, Q9U3H3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2004
Last sequence update: October 1, 2001
Last modified: August 12, 2020
This is version 156 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again