Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (16 Oct 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Type I inositol polyphosphate 5-phosphatase 13

Gene

IP5P13

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) to inositol 1,4-bisphosphate. Modulates cotyledon vein development through regulating auxin homeostasis. Involved in blue light responses. Decreases the amount of KIN10 degraded by the proteasome under low nutrient conditions. Participates with IP5P12 in the control of Ins(1,4,5)P3/Ca2+ levels that is crucial for maintaining pollen dormancy and regulating early germination of pollen. May modulate auxin transport by regulating vesicle trafficking and thereby plays a role in root gravitropism.6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=651 µM for Ins(1,4,5)P31 Publication

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase
    LigandMagnesium, Metal-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    ARA:AT1G05630-MONOMER
    MetaCyc:AT1G05630-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    3.1.3.36 399
    3.1.3.56 399

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Type I inositol polyphosphate 5-phosphatase 131 Publication (EC:3.1.3.561 Publication)
    Short name:
    At5PTase131 Publication
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:IP5P13Curated
    Synonyms:5PTASE131 Publication, IPP6
    Ordered Locus Names:At1g05630Imported
    ORF Names:F3F20.8Imported
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

    Organism-specific databases

    Arabidopsis Information Portal

    More...
    Araporti
    AT1G05630

    The Arabidopsis Information Resource

    More...
    TAIRi
    locus:2031933 AT1G05630

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

    Defect in development of the cotyledon veins. Altered auxin homeostasis and reduced abscisic acid sensitivity. Shortened hypocotyls and expanded cotyledons in response to blue light irradiation. Precocious pollen germination within anthers. Elevated sensitivity to gravistimulation in root gravitropic responses.5 Publications

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003597431 – 1136Type I inositol polyphosphate 5-phosphatase 13Add BLAST1136

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki940Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity

    Keywords - PTMi

    Isopeptide bond, Ubl conjugation

    Proteomic databases

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9SYK4

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9SYK4

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9SYK4

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in young seedlings and flowers. Highly expressed in anther and pollen grains, but not in pistils. Not detected in maturated roots, stems and rosette leaves.3 Publications

    <p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

    Detected in cotyledons prior to seed germination. Restricted to the cotyledon tip until 2 days after seed germination and then detected in the cotyledon or cotyledon veins on days 3 to 7.1 Publication

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    By abscisic acid, wounding and at a lower level, by cold and salt treatment. Down-regulated by blue light irradiation.2 Publications

    Gene expression databases

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9SYK4 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9SYK4 AT

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with KIN10, but not with PHOT1.

    1 Publication

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    22311, 1 interactor

    Protein interaction database and analysis system

    More...
    IntActi
    Q9SYK4, 1 interactor

    STRING: functional protein association networks

    More...
    STRINGi
    3702.AT1G05630.1

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati147 – 185WD 1Add BLAST39
    Repeati205 – 244WD 2Add BLAST40
    Repeati259 – 297WD 3Add BLAST39
    Repeati436 – 475WD 4Add BLAST40
    Repeati515 – 552WD 5Add BLAST38

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni782 – 798Catalytic 1By similarityAdd BLAST17
    Regioni861 – 876Catalytic 2By similarityAdd BLAST16

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The WD40 domain (1-533) is interacting with KIN10.

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG0565 Eukaryota
    COG5411 LUCA

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000242921

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9SYK4

    Database of Orthologous Groups

    More...
    OrthoDBi
    106112at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9SYK4

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    2.130.10.10, 2 hits
    3.60.10.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR036691 Endo/exonu/phosph_ase_sf
    IPR005135 Endo/exonuclease/phosphatase
    IPR000300 IPPc
    IPR015943 WD40/YVTN_repeat-like_dom_sf
    IPR001680 WD40_repeat

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF03372 Exo_endo_phos, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00128 IPPc, 1 hit
    SM00320 WD40, 4 hits

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF56219 SSF56219, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9SYK4-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MDSLIIEEED EEALATLVPV PPRRKTHSYS LQFDHKPHHQ IRKHSLDEVP
    60 70 80 90 100
    RSATLASEAV YFDSSDDEFS TGGNITENAA DETNAGAEEY TIVNPPPNVG
    110 120 130 140 150
    LGDDDTEPLP EFIGAGGGSG IFKVPVRAAV HPGRPPCLEL RPHPLRETQT
    160 170 180 190 200
    GRFLRNIACT ETQLWAGQEN GIRFWNLEDA YEAGCGIGGQ VPRGDEDTAP
    210 220 230 240 250
    FHESVTTSPT MCLVADQSNK LLWSGHKDGK IRAWKMDQSS VSHDDDDSDP
    260 270 280 290 300
    FKERVSWLAH RGPVNSIVIS SYGDMWSCSE GGVIKIWPWD TLEKSLLLKP
    310 320 330 340 350
    EEKHMAALLV ERSAIDLRSQ VTVNGTCSIS SSEVKFLLAD SVRAKVWAVQ
    360 370 380 390 400
    SLSFSIWDAR SKDLLKVLNV DGQVENRGDL PPIQDQQVDD EMKLKFFSAS
    410 420 430 440 450
    KREKPQGFLQ RSRNAIMGAA GAVRRVATRS AGAFSEDTRK TEAIVLAVDG
    460 470 480 490 500
    TIWTGSISGL IVQWDGNGNR LRDVNHHHRP VLCFCTFGDR IYVGYASGYI
    510 520 530 540 550
    QVLDLDGKLI SSWVSHNEPV IKLAAGGGFI FSLATHGGVR GWYVTSPGPL
    560 570 580 590 600
    DNIIRTELSQ KETLYARQDN VRILIGTWNV GQGRASHDAL MSWLGSVTSD
    610 620 630 640 650
    VGIVAVGLQE VEMGAGFLAM SAAKETVGLE GSAVGQWWID AIGKALDEKN
    660 670 680 690 700
    TFERMGSRQL AGLLISLWAR KDIRTHVGDL DVAAVPCGFG RAIGNKGGVG
    710 720 730 740 750
    LRIRVYDRIM CFVNCHLAAH LEAVNRRNAD FNHIFRLMVF SRGQNLSNAA
    760 770 780 790 800
    AAGVSTSAYT TKSNTIPSTG AEEIKSDLAA ADMVAFFGDF NYRLFGITYD
    810 820 830 840 850
    EARDFISQRS FDWLRERDQL RAEMKVGKVF QGMREALITF PPTYKFERNR
    860 870 880 890 900
    SGLGGYDSGE KKRIPAWCDR VIYRDTQSSP FSESNLQCPV VSSVIMYEAC
    910 920 930 940 950
    MDVTESDHKP VRCKFHATIA HVDKSVRRQE LGKIIRSNEK ILSIFEDLRF
    960 970 980 990 1000
    VPETSVSTNN IVLQSQDTVI LTITNNSPTS QAIFNILCGG QAVVKDDGED
    1010 1020 1030 1040 1050
    ADYNPRGSFG LPRWLEVSPA AGIINPEGSV DVKVHHEDFY SMEEYVDGIP
    1060 1070 1080 1090 1100
    QNWWCEDTRD KEAILMVNIR GSCSTTLRSH SVKVRHCFSA RVCLLENRPT
    1110 1120 1130
    NLTKNLGGSR RYPTDITRNG STRPRTEDSV RRGKSR
    Length:1,136
    Mass (Da):125,698
    Last modified:May 1, 2000 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4E90EE8E43900687
    GO
    Isoform 2 (identifier: Q9SYK4-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         750-750: A → AAGMVPYLFLSCSLGFSTYLFWLLYSSGLPWALSL

    Note: No experimental confirmation available.
    Show »
    Length:1,170
    Mass (Da):129,484
    Checksum:iEF5923AFF2C8CCFB
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    A0A1P8AU01A0A1P8AU01_ARATH
    Endonuclease/exonuclease/phosphatas...
    5PTASE13 AT5PTASE13, At1g05630, F3F20.8, F3F20_8
    919Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence CAC82096 differs from that shown. Reason: Frameshift.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti739V → I in CAC82096 (PubMed:11130712).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_036161750A → AAGMVPYLFLSCSLGFSTYL FWLLYSSGLPWALSL in isoform 2. Curated1

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AY761188 mRNA Translation: AAV87315.1
    AY761192 Genomic DNA Translation: AAV87319.1
    AC007153 Genomic DNA Translation: AAD30615.1
    CP002684 Genomic DNA Translation: AEE27868.1
    CP002684 Genomic DNA Translation: AEE27869.1
    AJ297426 mRNA Translation: CAC82096.1 Frameshift.

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    D86190

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001030976.1, NM_001035899.2 [Q9SYK4-1]
    NP_172054.3, NM_100443.5 [Q9SYK4-2]

    Genome annotation databases

    Ensembl plant genome annotation project

    More...
    EnsemblPlantsi
    AT1G05630.1; AT1G05630.1; AT1G05630 [Q9SYK4-2]
    AT1G05630.2; AT1G05630.2; AT1G05630 [Q9SYK4-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    837069

    Gramene; a comparative resource for plants

    More...
    Gramenei
    AT1G05630.1; AT1G05630.1; AT1G05630 [Q9SYK4-2]
    AT1G05630.2; AT1G05630.2; AT1G05630 [Q9SYK4-1]

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    ath:AT1G05630

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AY761188 mRNA Translation: AAV87315.1
    AY761192 Genomic DNA Translation: AAV87319.1
    AC007153 Genomic DNA Translation: AAD30615.1
    CP002684 Genomic DNA Translation: AEE27868.1
    CP002684 Genomic DNA Translation: AEE27869.1
    AJ297426 mRNA Translation: CAC82096.1 Frameshift.
    PIRiD86190
    RefSeqiNP_001030976.1, NM_001035899.2 [Q9SYK4-1]
    NP_172054.3, NM_100443.5 [Q9SYK4-2]

    3D structure databases

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    SWISS-MODEL Interactive Workspace

    More...
    SWISS-MODEL-Workspacei
    Submit a new modelling project...

    Protein-protein interaction databases

    BioGridi22311, 1 interactor
    IntActiQ9SYK4, 1 interactor
    STRINGi3702.AT1G05630.1

    PTM databases

    iPTMnetiQ9SYK4

    Proteomic databases

    PaxDbiQ9SYK4
    PRIDEiQ9SYK4

    Genome annotation databases

    EnsemblPlantsiAT1G05630.1; AT1G05630.1; AT1G05630 [Q9SYK4-2]
    AT1G05630.2; AT1G05630.2; AT1G05630 [Q9SYK4-1]
    GeneIDi837069
    GrameneiAT1G05630.1; AT1G05630.1; AT1G05630 [Q9SYK4-2]
    AT1G05630.2; AT1G05630.2; AT1G05630 [Q9SYK4-1]
    KEGGiath:AT1G05630

    Organism-specific databases

    AraportiAT1G05630
    TAIRilocus:2031933 AT1G05630

    Phylogenomic databases

    eggNOGiKOG0565 Eukaryota
    COG5411 LUCA
    HOGENOMiHOG000242921
    InParanoidiQ9SYK4
    OrthoDBi106112at2759
    PhylomeDBiQ9SYK4

    Enzyme and pathway databases

    BioCyciARA:AT1G05630-MONOMER
    MetaCyc:AT1G05630-MONOMER
    BRENDAi3.1.3.36 399
    3.1.3.56 399

    Miscellaneous databases

    Protein Ontology

    More...
    PROi
    PR:Q9SYK4

    Gene expression databases

    ExpressionAtlasiQ9SYK4 baseline and differential
    GenevisibleiQ9SYK4 AT

    Family and domain databases

    Gene3Di2.130.10.10, 2 hits
    3.60.10.10, 1 hit
    InterProiView protein in InterPro
    IPR036691 Endo/exonu/phosph_ase_sf
    IPR005135 Endo/exonuclease/phosphatase
    IPR000300 IPPc
    IPR015943 WD40/YVTN_repeat-like_dom_sf
    IPR001680 WD40_repeat
    PfamiView protein in Pfam
    PF03372 Exo_endo_phos, 1 hit
    SMARTiView protein in SMART
    SM00128 IPPc, 1 hit
    SM00320 WD40, 4 hits
    SUPFAMiSSF56219 SSF56219, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIP5PD_ARATH
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9SYK4
    Secondary accession number(s): F4IAA0, Q712D7
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 20, 2009
    Last sequence update: May 1, 2000
    Last modified: October 16, 2019
    This is version 147 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again