UniProtKB - Q9RY64 (RL21_DEIRA)

BLAST

>sp|Q9RY64|RL21_DEIRA 50S ribosomal protein L21 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=rplU PE=1 SV=2
MFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTVFGEDAGKYTVQAEV
VEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGIQG

Align
Format
Add to basket Added to basket
History
Entry version 118 (10 Oct 2018)
Sequence version 2 (15 Mar 2004)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L21

Gene

rplU

Organism

Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Binds directly to 23S rRNA, probably serving to organize its structure.

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: GO_Central

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L21UniRule annotation
Gene namesⁱ	Name:rplUUniRule annotation Ordered Locus Names:DR_0086
Organismⁱ	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Taxonomic identifierⁱ	243230 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Terrabacteria group › Deinococcus-Thermus › Deinococci › Deinococcales › Deinococcaceae › Deinococcus › Deinococcus radiodurans
Proteomesⁱ	UP000002524 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000180999	1 – 100	50S ribosomal protein L21Add BLAST		100

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Contacts proteins L15 and L20.UniRule annotation6 Publications

Protein-protein interaction databases

STRINGⁱ	243230.DR_0086

STRINGⁱ

243230.DR_0086

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	6 – 8	Combined sources	3
Beta strandⁱ	21 – 23	Combined sources	3
Beta strandⁱ	26 – 28	Combined sources	3
Beta strandⁱ	32 – 36	Combined sources	5
Beta strandⁱ	37 – 39	Combined sources	3
Beta strandⁱ	41 – 44	Combined sources	4
Helixⁱ	49 – 53	Combined sources	5
Beta strandⁱ	54 – 65	Combined sources	12
Beta strandⁱ	69 – 75	Combined sources	7
Turnⁱ	76 – 79	Combined sources	4
Beta strandⁱ	80 – 86	Combined sources	7
Beta strandⁱ	89 – 95	Combined sources	7

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9RY64
SMRⁱ	Q9RY64
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q9RY64

EvolutionaryTraceⁱ

Q9RY64

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the bacterial ribosomal protein bL21 family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	ENOG4105KK9 Bacteria COG0261 LUCA
InParanoidⁱ	Q9RY64
KEGG Orthology (KO) More...KOⁱ	K02888
OMAⁱ	GHRQQYT
Database of Orthologous Groups More...OrthoDBⁱ	POG091H02LM

Family and domain databases

HAMAPⁱ	MF_01363 Ribosomal_L21, 1 hit
InterProⁱ	View protein in InterPro IPR036164 L21-like_sf IPR028909 L21p-like IPR001787 Ribosomal_L21
PANTHERⁱ	PTHR21349 PTHR21349, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00829 Ribosomal_L21p, 1 hit
SUPFAMⁱ	SSF141091 SSF141091, 1 hit
TIGRFAMsⁱ	TIGR00061 L21, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Q9RY64-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MFAIIQTGGK QYRVSEGDVI RVESLQGEAG DKVELKALFV GGEQTVFGED 
        60         70         80         90        100
AGKYTVQAEV VEHGRGKKIY IRKYKSGVQY RRRTGHRQNF TAIKILGIQG

Length:100

Mass (Da):11,147

Last modified:March 15, 2004 - v2

Checksum:ⁱ98F6DEFE41810D1F

Sequence cautionⁱ

The sequence AAF09679 differs from that shown. Reason: Erroneous initiation.Curated

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AE000513 Genomic DNA Translation: AAF09679.1 Different initiation.
PIRⁱ	F75560
NCBI Reference Sequences More...RefSeqⁱ	NP_293812.1, NC_001263.1 WP_027480310.1, NZ_CP015081.1

Genome annotation databases

EnsemblBacteriaⁱ	AAF09679; AAF09679; DR_0086
GeneIDⁱ	1799181
KEGGⁱ	dra:DR_0086
PATRICⁱ	fig\|243230.17.peg.250

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AE000513 Genomic DNA Translation: AAF09679.1 Different initiation.
PIRⁱ	F75560
RefSeqⁱ	NP_293812.1, NC_001263.1 WP_027480310.1, NZ_CP015081.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1NKW	X-ray	3.10	P	1-100	[»]
	1NWX	X-ray	3.50	P	1-100	[»]
	1NWY	X-ray	3.30	P	1-100	[»]
	1SM1	X-ray	3.42	P	1-100	[»]
	1XBP	X-ray	3.50	P	1-100	[»]
	2ZJP	X-ray	3.70	O	1-100	[»]
	2ZJQ	X-ray	3.30	O	1-100	[»]
	2ZJR	X-ray	2.91	O	1-100	[»]
	3CF5	X-ray	3.30	O	1-100	[»]
	3DLL	X-ray	3.50	O	1-100	[»]
	3PIO	X-ray	3.25	O	1-100	[»]
	3PIP	X-ray	3.45	O	1-100	[»]
	4IO9	X-ray	3.20	O	1-100	[»]
	4IOA	X-ray	3.20	O	1-100	[»]
	4IOC	X-ray	3.60	O	1-100	[»]
	4U67	X-ray	3.65	O	1-100	[»]
	4V49	X-ray	8.70	P	1-100	[»]
	4V4A	X-ray	9.50	P	1-100	[»]
	4V4G	X-ray	11.50	S	1-100	[»]
	4V4T	X-ray	6.46	V	1-100	[»]
	4WFN	X-ray	3.54	O	1-100	[»]
	5DM6	X-ray	2.90	O	5-98	[»]
	5DM7	X-ray	3.00	O	5-98	[»]
	5JVG	X-ray	3.43	O	1-100	[»]
	5JVH	X-ray	3.58	O	1-100	[»]
ProteinModelPortalⁱ	Q9RY64
SMRⁱ	Q9RY64
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	243230.DR_0086

STRINGⁱ

243230.DR_0086

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAF09679; AAF09679; DR_0086
GeneIDⁱ	1799181
KEGGⁱ	dra:DR_0086
PATRICⁱ	fig\|243230.17.peg.250

Phylogenomic databases

eggNOGⁱ	ENOG4105KK9 Bacteria COG0261 LUCA
InParanoidⁱ	Q9RY64
KOⁱ	K02888
OMAⁱ	GHRQQYT
OrthoDBⁱ	POG091H02LM

Miscellaneous databases

EvolutionaryTraceⁱ	Q9RY64

EvolutionaryTraceⁱ

Q9RY64

Family and domain databases

HAMAPⁱ	MF_01363 Ribosomal_L21, 1 hit
InterProⁱ	View protein in InterPro IPR036164 L21-like_sf IPR028909 L21p-like IPR001787 Ribosomal_L21
PANTHERⁱ	PTHR21349 PTHR21349, 1 hit
Pfamⁱ	View protein in Pfam PF00829 Ribosomal_L21p, 1 hit
SUPFAMⁱ	SSF141091 SSF141091, 1 hit
TIGRFAMsⁱ	TIGR00061 L21, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL21_DEIRA
Accessionⁱ	Q9RY64Primary (citable) accession number: Q9RY64
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 15, 2004
	Last sequence update:	March 15, 2004
	Last modified:	October 10, 2018
	This is version 118 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9RY64 (RL21_DEIRA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L21

rplU

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ