Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (17 Jun 2020)
Sequence version 2 (05 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

C-Jun-amino-terminal kinase-interacting protein 1

Gene

Mapk8ip1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. Required for JNK activation in response to excitotoxic stress. Cytoplasmic MAPK8IP1 causes inhibition of JNK-regulated activity by retaining JNK in the cytoplasm and thus inhibiting the JNK phosphorylation of c-Jun. May also participate in ApoER2-specific reelin signaling. Directly, or indirectly, regulates GLUT2 gene expression and beta-cell function. Appears to have a role in cell signaling in mature and developing nerve terminals. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins. Functions as an anti-apoptotic protein and whose level seems to influence the beta-cell death or survival response. Acts as a scaffold protein that coordinates with SH3RF1 in organizing different components of the JNK pathway, including RAC1 or RAC2, MAP3K11/MLK3 or MAP3K7/TAK1, MAP2K7/MKK7, MAPK8/JNK1 and/or MAPK9/JNK2 into a functional multiprotein complex to ensure the effective activation of the JNK signaling pathway. Regulates the activation of MAPK8/JNK1 and differentiation of CD8+ T-cells.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-Jun-amino-terminal kinase-interacting protein 1
Short name:
JIP-1
Short name:
JNK-interacting protein 1
Alternative name(s):
Islet-brain-1
Short name:
IB-1
JIP-1-related protein
Short name:
JRP
JNK MAP kinase scaffold protein 1
Mitogen-activated protein kinase 8-interacting protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mapk8ip1
Synonyms:Ib1, Jip1, Mapk8ip
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Rat genome database

More...
RGDi
70937 Mapk8ip1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Membrane, Mitochondrion, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002206301 – 708C-Jun-amino-terminal kinase-interacting protein 1Add BLAST708

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei14PhosphoserineCombined sources1
Modified residuei28PhosphoserineCombined sources1
Modified residuei39PhosphoserineBy similarity1
Modified residuei103Phosphothreonine; by MAPK8, MAPK9 and MAPK10By similarity1
Modified residuei149PhosphoserineBy similarity1
Modified residuei178PhosphoserineBy similarity1
Modified residuei184PhosphoserineBy similarity1
Modified residuei190PhosphoserineBy similarity1
Modified residuei192PhosphoserineBy similarity1
Modified residuei193PhosphoserineBy similarity1
Modified residuei202Phosphothreonine; by MAPK8, MAPK9 and MAPK10By similarity1
Modified residuei211PhosphoserineBy similarity1
Modified residuei308PhosphoserineBy similarity1
Modified residuei325PhosphoserineBy similarity1
Modified residuei327PhosphoserineBy similarity1
Modified residuei337PhosphoserineBy similarity1
Modified residuei352PhosphoserineBy similarity1
Modified residuei363PhosphoserineBy similarity1
Modified residuei366PhosphoserineBy similarity1
Modified residuei404PhosphoserineBy similarity1
Modified residuei406PhosphoserineBy similarity1
Modified residuei408PhosphothreonineBy similarity1
Modified residuei441PhosphoserineBy similarity1
Modified residuei444PhosphoserineBy similarity1
Modified residuei445PhosphothreonineBy similarity1
Modified residuei466PhosphoserineBy similarity1
Modified residuei468PhosphoserineBy similarity1
Modified residuei469PhosphoserineBy similarity1
Modified residuei470PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by MAPK8, MAPK9 and MAPK10. Phosphorylation on Thr-103 is also necessary for the dissociation and activation of MAP3K12. Phosphorylated by VRK2. Hyperphosphorylated during mitosis following activation of stress-activated and MAP kinases (By similarity).By similarity
Ubiquitinated. Two preliminary events are required to prime for ubiquitination; phosphorylation and an increased in intracellular calcium concentration. Then, the calcium influx initiates ubiquitination and degradation by the ubiquitin-proteasome pathway (By similarity).By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9R237

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9R237

PRoteomics IDEntifications database

More...
PRIDEi
Q9R237

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9R237

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9R237

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in brain and pancreatic beta-cells. Weaker expression found in kidney.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000058478 Expressed in brain and 9 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms homo- or heterooligomeric complexes (PubMed:16456539). Binds specific components of the JNK signaling pathway namely MAPK8/JNK1, MAPK9/JNK2, MAPK10/JNK3, MAP2K7/MKK7, MAP3K11/MLK3 and DLK1. Also binds the proline-rich domain-containing splice variant of apolipoprotein E receptor 2 (ApoER2).

Interacts, via the PID domain, with ARHGEF28 (By similarity). Binds the cytoplasmic tails of LRP1 and LRP2 (Megalin). Binds the TPR motif-containing C-terminal of kinesin light chain, KLC1. Pre-assembled MAPK8IP1 scaffolding complexes are then transported as a cargo of kinesin, to the required subcellular location.

Interacts with the cytoplasmic domain of APP (By similarity).

Interacts with DCLK2, VRK2 and MAP3K7/TAK1.

Found in a complex with SH3RF1, RAC1, MAP3K11/MLK3, MAP2K7/MKK7 and MAPK8/JNK1.

Found in a complex with SH3RF1, RAC2, MAP3K7/TAK1, MAP2K7/MKK7, MAPK8/JNK1 and MAPK9/JNK2 (By similarity).

Interacts with SH3RF2 (PubMed:22128169).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9R237, 6 interactors

Molecular INTeraction database

More...
MINTi
Q9R237

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000065176

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1708
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9R237

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9R237

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini485 – 546SH3PROSITE-ProRule annotationAdd BLAST62
Domaini558 – 697PIDPROSITE-ProRule annotationAdd BLAST140

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni126 – 282JNK-binding domain (JBD)Add BLAST157
Regioni154 – 173Minimal inhibitory domain (MID)Add BLAST20
Regioni280 – 468Interaction with MAP3K7By similarityAdd BLAST189
Regioni468 – 657Interaction with VRK2By similarityAdd BLAST190

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi350 – 357D-box 18
Motifi361 – 369D-box 29

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi41 – 47Asp/Glu-rich (acidic)7
Compositional biasi107 – 115Asp/Glu-rich (acidic)9
Compositional biasi356 – 360Poly-Pro5

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 domain mediates homodimerization.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the JIP scaffold family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3775 Eukaryota
ENOG410ZFRJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157089

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9R237

KEGG Orthology (KO)

More...
KOi
K04434

Identification of Orthologs from Complete Genome Data

More...
OMAi
QGNKCSH

Database of Orthologous Groups

More...
OrthoDBi
372907at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9R237

TreeFam database of animal gene trees

More...
TreeFami
TF325073

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11943 SH3_JIP1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035638 JIP1_SH3
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00640 PID, 1 hit
PF14604 SH3_9, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00462 PTB, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01179 PID, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9R237-1) [UniParc]FASTAAdd to basket
Also known as: JIP-1a, JIP-1b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAERESGLSG GAASPPAASP FLGLHIASPP NFRLTHDISL EEFEDEDLSE
60 70 80 90 100
ITDECGISLQ CKDTLSLRPP RAGLLSAGSS GSAGSRLQAE MLQMDLIDAA
110 120 130 140 150
SDTPGAEDDE EDDDELAAQR PGVGPSKAES GQEPASRSQG QGQGPGTGSG
160 170 180 190 200
DTYRPKRPTT LNLFPQVPRS QDTLNNNSLG KKHSWQDRVS RSSSPLKTGE
210 220 230 240 250
QTPPHEHICL SDELPPQGSP VPTQDRGTST DSPCRRTAAT QMAPPSGPPA
260 270 280 290 300
TAPGGRGHSH RDRIHYQADV RLEATEEIYL TPVQRPPDPA EPTSTFLPPT
310 320 330 340 350
ESRMSVSSDP DPAAYSVTAG RPHPSISEED EGFDCLSSPE QAEPPGGGWR
360 370 380 390 400
GSLGEPPPPP RASLSSDTSA LSYDSVKYTL VVDEHAQLEL VSLRPCFGDY
410 420 430 440 450
SDESDSATVY DNCASASSPY ESAIGEEYEE APQPRPPTCL SEDSTPDEPD
460 470 480 490 500
VHFSKKFLNV FMSGRSRSSS AESFGLFSCV INGEEHEQTH RAIFRFVPRH
510 520 530 540 550
EDELELEVDD PLLVELQAED YWYEAYNMRT GARGVFPAYY AIEVTKEPEH
560 570 580 590 600
MAALAKNSDW IDQFRVKFLG SVQVPYHKGN DVLCAAMQKI ATTRRLTVHF
610 620 630 640 650
NPPSSCVLEI SVRGVKIGVK ADEAQEAKGN KCSHFFQLKN ISFCGYHPKN
660 670 680 690 700
NKYFGFITKH PADHRFACHV FVSEDSTKAL AESVGRAFQQ FYKQFVEYTC

PTEDIYLE
Length:708
Mass (Da):77,318
Last modified:December 5, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4923FD55F1C511F4
GO
Isoform 2 (identifier: Q9R237-2) [UniParc]FASTAAdd to basket
Also known as: JIP-1c, 2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MAERESGLSGGAASPPAASPFLGLHIASPPNFR → MQLVLKMDSSPDNDSWLEDQWERW

Show »
Length:699
Mass (Da):77,034
Checksum:i0DA066706C827D27
GO
Isoform 3 (identifier: Q9R237-3) [UniParc]FASTAAdd to basket
Also known as: JIP-1d

The sequence of this isoform differs from the canonical sequence as follows:
     69-93: Missing.
     708-708: E → EPMAQVQLQVDLEIKRAAAEQKLISEEDLNGAA

Show »
Length:715
Mass (Da):78,356
Checksum:i21DFC770F875277B
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD22543 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAD38351 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti38I → V in AAC62110 (Ref. 2) Curated1
Sequence conflicti149S → C in AAD22543 (PubMed:9442013).Curated1
Sequence conflicti384E → D in ABD24062 (PubMed:21076496).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0027671 – 33MAERE…PPNFR → MQLVLKMDSSPDNDSWLEDQ WERW in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_00276869 – 93Missing in isoform 3. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_002769708E → EPMAQVQLQVDLEIKRAAAE QKLISEEDLNGAA in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF108959 mRNA Translation: AAD22543.1 Different initiation.
AF092450 mRNA Translation: AAC62110.1
AF109772 mRNA Translation: AAD38350.1
AF109773 mRNA Translation: AAD38351.1 Different initiation.
AF109774 mRNA Translation: AAD38352.1
DQ377223 mRNA Translation: ABD24062.1

NCBI Reference Sequences

More...
RefSeqi
NP_446229.1, NM_053777.1 [Q9R237-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000079746; ENSRNOP00000074684; ENSRNOG00000058478 [Q9R237-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
116457

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:116457

UCSC genome browser

More...
UCSCi
RGD:70937 rat [Q9R237-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF108959 mRNA Translation: AAD22543.1 Different initiation.
AF092450 mRNA Translation: AAC62110.1
AF109772 mRNA Translation: AAD38350.1
AF109773 mRNA Translation: AAD38351.1 Different initiation.
AF109774 mRNA Translation: AAD38352.1
DQ377223 mRNA Translation: ABD24062.1
RefSeqiNP_446229.1, NM_053777.1 [Q9R237-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2FPDX-ray2.05A/B/C/D487-546[»]
2FPEX-ray1.75A/B/C/D/E/F/G/H487-546[»]
2FPFX-ray3.00A/B/C/D482-552[»]
SMRiQ9R237
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

IntActiQ9R237, 6 interactors
MINTiQ9R237
STRINGi10116.ENSRNOP00000065176

PTM databases

iPTMnetiQ9R237
PhosphoSitePlusiQ9R237

Proteomic databases

jPOSTiQ9R237
PaxDbiQ9R237
PRIDEiQ9R237

Genome annotation databases

EnsembliENSRNOT00000079746; ENSRNOP00000074684; ENSRNOG00000058478 [Q9R237-2]
GeneIDi116457
KEGGirno:116457
UCSCiRGD:70937 rat [Q9R237-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9479
RGDi70937 Mapk8ip1

Phylogenomic databases

eggNOGiKOG3775 Eukaryota
ENOG410ZFRJ LUCA
GeneTreeiENSGT00940000157089
InParanoidiQ9R237
KOiK04434
OMAiQGNKCSH
OrthoDBi372907at2759
PhylomeDBiQ9R237
TreeFamiTF325073

Miscellaneous databases

EvolutionaryTraceiQ9R237

Protein Ontology

More...
PROi
PR:Q9R237

Gene expression databases

BgeeiENSRNOG00000058478 Expressed in brain and 9 other tissues

Family and domain databases

CDDicd11943 SH3_JIP1, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035638 JIP1_SH3
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00640 PID, 1 hit
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiJIP1_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9R237
Secondary accession number(s): B0VXR5
, O88979, Q9R1H8, Q9WVI5, Q9WVI6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: December 5, 2001
Last modified: June 17, 2020
This is version 163 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again