Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disintegrin and metalloproteinase domain-containing protein 22

Gene

Adam22

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation (By similarity). Neuronal receptor for LGI1.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

  • adult locomotory behavior Source: MGI
  • gliogenesis Source: MGI
  • myelination in peripheral nervous system Source: MGI
  • Schwann cell differentiation Source: MGI

Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

ReactomeiR-MMU-5682910 LGI-ADAM interactions

Protein family/group databases

MEROPSiM12.978

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 22
Short name:
ADAM 22
Gene namesi
Name:Adam22
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1340046 Adam22

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 734ExtracellularSequence analysisAdd BLAST711
Transmembranei735 – 755HelicalSequence analysisAdd BLAST21
Topological domaini756 – 857CytoplasmicSequence analysisAdd BLAST102

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Disruption phenotypei

Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi509D → N: Fails to bind to LGI1. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
PropeptideiPRO_000002911424 – 223By similarityAdd BLAST200
ChainiPRO_0000029115224 – 904Disintegrin and metalloproteinase domain-containing protein 22Add BLAST681

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi163N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi347 ↔ 431By similarity
Disulfide bondi390 ↔ 415By similarity
Disulfide bondi392 ↔ 399By similarity
Disulfide bondi445 ↔ 475By similarity
Disulfide bondi456 ↔ 472By similarity
Disulfide bondi458 ↔ 464By similarity
Disulfide bondi471 ↔ 492By similarity
Disulfide bondi483 ↔ 489By similarity
Disulfide bondi488 ↔ 514By similarity
Disulfide bondi501 ↔ 521By similarity
Disulfide bondi508 ↔ 540By similarity
Glycosylationi517N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi533 ↔ 545By similarity
Disulfide bondi552 ↔ 603By similarity
Disulfide bondi567 ↔ 633By similarity
Disulfide bondi581 ↔ 591By similarity
Disulfide bondi598 ↔ 661By similarity
Glycosylationi632N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi655 ↔ 666By similarity
Glycosylationi673N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi677 ↔ 692By similarity
Disulfide bondi686 ↔ 698By similarity
Disulfide bondi700 ↔ 709By similarity
Modified residuei808PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei855PhosphoserineCombined sources1
Modified residuei860PhosphoserineCombined sources1
Modified residuei864PhosphoserineCombined sources1
Modified residuei868PhosphoserineCombined sources1
Isoform 8 (identifier: Q9R1V6-10)
Modified residuei817PhosphoserineCombined sources1
Isoform 12 (identifier: Q9R1V6-14)
Modified residuei882PhosphoserineCombined sources1

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9R1V6
PaxDbiQ9R1V6
PeptideAtlasiQ9R1V6
PRIDEiQ9R1V6

PTM databases

iPTMnetiQ9R1V6
PhosphoSitePlusiQ9R1V6

Expressioni

Tissue specificityi

Detected in juxtaparanodal zones in the central nervous system and at nerve terminal plexuses of basket cells in the cerebellum (at protein level) (PubMed:20089912). Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter.2 Publications

Gene expression databases

BgeeiENSMUSG00000040537
CleanExiMM_ADAM22
ExpressionAtlasiQ9R1V6 baseline and differential
GenevisibleiQ9R1V6 MM

Interactioni

Subunit structurei

Interacts with LGI1 (PubMed:18974846, PubMed:20089912). Can bind to LGI4(PubMed:18974846). Interacts with KCNA2, DLG2 and DLG4 (PubMed:20089912).3 Publications

Protein-protein interaction databases

BioGridi197967, 4 interactors
IntActiQ9R1V6, 8 interactors
MINTiQ9R1V6
STRINGi10090.ENSMUSP00000055000

Structurei

3D structure databases

ProteinModelPortaliQ9R1V6
SMRiQ9R1V6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini237 – 436Peptidase M12BPROSITE-ProRule annotationAdd BLAST200
Domaini442 – 529DisintegrinPROSITE-ProRule annotationAdd BLAST88
Domaini673 – 710EGF-likePROSITE-ProRule annotationAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi533 – 666Cys-richAdd BLAST134

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3607 Eukaryota
ENOG410XX2M LUCA
GeneTreeiENSGT00910000144014
HOVERGENiHBG050456
InParanoidiQ9R1V6
KOiK16068
OMAiTRDRQCK
OrthoDBiEOG091G010C
PhylomeDBiQ9R1V6
TreeFamiTF314733

Family and domain databases

CDDicd04269 ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR006586 ADAM_Cys-rich
IPR018358 Disintegrin_CS
IPR001762 Disintegrin_dom
IPR036436 Disintegrin_dom_sf
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR013111 EGF_extracell
IPR024079 MetalloPept_cat_dom_sf
IPR001590 Peptidase_M12B
IPR002870 Peptidase_M12B_N
IPR034027 Reprolysin_adamalysin
PfamiView protein in Pfam
PF08516 ADAM_CR, 1 hit
PF00200 Disintegrin, 1 hit
PF07974 EGF_2, 1 hit
PF01562 Pep_M12B_propep, 1 hit
PF01421 Reprolysin, 1 hit
PRINTSiPR00289 DISINTEGRIN
SMARTiView protein in SMART
SM00608 ACR, 1 hit
SM00050 DISIN, 1 hit
SUPFAMiSSF57552 SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215 ADAM_MEPRO, 1 hit
PS00427 DISINTEGRIN_1, 1 hit
PS50214 DISINTEGRIN_2, 1 hit
PS00022 EGF_1, 1 hit
PS50026 EGF_3, 1 hit

Sequences (21)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 21 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9R1V6-3) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G01, 22g

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP
60 70 80 90 100
LRLIYRLGGE DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL
110 120 130 140 150
DVLLNHELLS SGYVERQIEH GGKVVENKGG EHCYYQGQIR GNPVSFVALS
160 170 180 190 200
TCHGLHGMFY DGNHTYLIEP EENEKSQESS HCHSVYKSRQ FEFPLDDLPS
210 220 230 240 250
EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE LMIVNDHLMF
260 270 280 290 300
KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS
310 320 330 340 350
ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL
360 370 380 390 400
RGGGVNEFGK TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI
410 420 430 440 450
MGDTGYYLPK KFTQCNVEEY HDFLNSGGGA CLFNKPSKLL DPPECGNGFI
460 470 480 490 500
ETGEECDCGT PAECALEGAE CCKKCTLTQD SQCSDGLCCK KCKFQPLGTV
510 520 530 540 550
CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC FGGRCKTRDR
560 570 580 590 600
QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY
610 620 630 640 650
LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE
660 670 680 690 700
DGTPCGPQMM CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC
710 720 730 740 750
NRHWTGADCG THFPHNDDAK TGITLSGNGV AGTNIIIGII AGTILVLALI
760 770 780 790 800
LGITAWGYKN YREQRQLPQG DYVKKPGDGD SFYSDFPPGG STNSASSSKK
810 820 830 840 850
RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN KKKIRGKRFR
860 870 880 890 900
PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW

ETSI
Length:904
Mass (Da):99,715
Last modified:May 2, 2006 - v2
Checksum:i0FBBD09398EE0B97
GO
Isoform 2 (identifier: Q9R1V6-4) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G03, 22g(D27)

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.

Show »
Length:868
Mass (Da):95,927
Checksum:iC0FA966057D2C5C8
GO
Isoform 3 (identifier: Q9R1V6-5) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G06, 22g(D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.

Show »
Length:862
Mass (Da):95,080
Checksum:i17E4012489871450
GO
Isoform 4 (identifier: Q9R1V6-6) [UniParc]FASTAAdd to basket
Also known as: ADAM22=G07, 22g(D26D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:899
Mass (Da):98,855
Checksum:iDAFB8A148524416E
GO
Isoform 5 (identifier: Q9R1V6-7) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G08, 22g(D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:905
Mass (Da):99,702
Checksum:i6AAA73D541AFB536
GO
Isoform 6 (identifier: Q9R1V6-8) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G09, 22g+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:941
Mass (Da):103,490
Checksum:iD23B93F0032CBBCF
GO
Isoform 7 (identifier: Q9R1V6-9) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G10, 22g+29.1

The sequence of this isoform differs from the canonical sequence as follows:
     857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT

Show »
Length:862
Mass (Da):95,224
Checksum:i30A066885BBA38FB
GO
Isoform 8 (identifier: Q9R1V6-10) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G11, 22g(D27)+29.5+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR

Show »
Length:907
Mass (Da):100,669
Checksum:iE228AF65D914F778
GO
Isoform 9 (identifier: Q9R1V6-11) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G12, 22g+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:970
Mass (Da):107,122
Checksum:iABBCD4AD024F349B
GO
Isoform 10 (identifier: Q9R1V6-12) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G17, 22G[27L]+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR

Show »
Length:980
Mass (Da):107,831
Checksum:i45BE20975A1D5820
GO
Isoform 11 (identifier: Q9R1V6-13) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G18, 22g(D26)[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:927
Mass (Da):102,129
Checksum:iBD4C6B317C47EFAB
GO
Isoform 12 (identifier: Q9R1V6-14) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G19, 22g[27L]+29.5

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:962
Mass (Da):106,608
Checksum:iD77057A06FD2A7E4
GO
Isoform 13 (identifier: Q9R1V6-15) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G20, 22g[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:933
Mass (Da):102,976
Checksum:i1052AC188694EDFC
GO
Isoform 14 (identifier: Q9R1V6-16) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G21, 22g(D26)[27S]

The sequence of this isoform differs from the canonical sequence as follows:
     760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF

Show »
Length:883
Mass (Da):97,640
Checksum:iC3A2C695E08B72F9
GO
Isoform 15 (identifier: Q9R1V6-17) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G22, 22g(D27)+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → DSQDGPHQQDR

Show »
Length:878
Mass (Da):97,062
Checksum:i251D63D6D6CAF0A3
GO
Isoform 16 (identifier: Q9R1V6-18) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G23, 22g(D25D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF

Show »
Length:832
Mass (Da):92,271
Checksum:i6BB6F0B5CA150F28
GO
Isoform 17 (identifier: Q9R1V6-2) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A05, Beta

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     858-904: Missing.

Show »
Length:821
Mass (Da):90,952
Checksum:i4F8F12B425EB683C
GO
Isoform 18 (identifier: Q9R1V6-19) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A13

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     858-904: Missing.

Show »
Length:815
Mass (Da):90,105
Checksum:i59F2A397E25E283F
GO
Isoform 19 (identifier: Q9R1V6-20) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A15

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     858-904: Missing.

Show »
Length:851
Mass (Da):93,893
Checksum:iB1A6A8713614459E
GO
Isoform 20 (identifier: Q9R1V6-1) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A04, Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     858-904: Missing.

Show »
Length:857
Mass (Da):94,740
Checksum:iCB88FB7000208E09
GO
Isoform 21 (identifier: Q9R1V6-21) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A16

The sequence of this isoform differs from the canonical sequence as follows:
     766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL
     847-904: Missing.

Show »
Length:846
Mass (Da):93,592
Checksum:i08A647F010B67028
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti639K → R in BAC28742 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018233730 – 904VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_018234760 – 904NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14. 1 PublicationAdd BLAST145
Alternative sequenceiVSP_018235760 – 801Missing in isoform 3, isoform 4 and isoform 18. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_018236760 – 765Missing in isoform 11 and isoform 19. 1 Publication6
Alternative sequenceiVSP_018237766 – 846QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_018238766 – 801Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_018239802S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13. 1 Publication1
Alternative sequenceiVSP_018240847 – 904Missing in isoform 21. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_018241857 – 904ETLSP…WETSI → DLGIIT in isoform 7. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_018242857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10. 1 Publication1
Alternative sequenceiVSP_018243857E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12. 1 Publication1
Alternative sequenceiVSP_018244857E → DSQDGPHQQDR in isoform 15. 1 Publication1
Alternative sequenceiVSP_018245857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6. 1 Publication1
Alternative sequenceiVSP_018246857E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8. 1 Publication1
Alternative sequenceiVSP_018247857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9. 1 Publication1
Alternative sequenceiVSP_018248858 – 904Missing in isoform 17, isoform 18, isoform 19 and isoform 20. 2 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009674 mRNA Translation: BAA83382.1
AB009674 mRNA Translation: BAA83383.1
AK034528 mRNA Translation: BAC28742.1
AB179842 mRNA Translation: BAD72803.1
AB179843 mRNA Translation: BAD72804.1
AB179844 mRNA Translation: BAD72805.1
AB179845 mRNA Translation: BAD72806.1
AB179846 mRNA Translation: BAD72807.1
AB179847 mRNA Translation: BAD72808.1
AB179848 mRNA Translation: BAD72809.1
AB179849 mRNA Translation: BAD72810.1
AB179850 mRNA Translation: BAD72811.1
AB179851 mRNA Translation: BAD72812.1
AB179852 mRNA Translation: BAD72813.1
AB179853 mRNA Translation: BAD72814.1
AB179854 mRNA Translation: BAD72815.1
AB179855 mRNA Translation: BAD72816.1
AB179856 mRNA Translation: BAD72817.1
AB179857 mRNA Translation: BAD72818.1
AB179858 mRNA Translation: BAD72819.1
AB179859 mRNA Translation: BAD72820.1
AB179860 mRNA Translation: BAD72821.1
AB179861 mRNA Translation: BAD72822.1
AB179862 mRNA Translation: BAD72823.1
CCDSiCCDS19080.1 [Q9R1V6-1]
CCDS51411.1 [Q9R1V6-4]
CCDS80205.1 [Q9R1V6-6]
CCDS80207.1 [Q9R1V6-3]
RefSeqiNP_001007221.1, NM_001007220.3 [Q9R1V6-1]
NP_001007222.1, NM_001007221.3 [Q9R1V6-2]
NP_001091695.1, NM_001098225.2 [Q9R1V6-4]
NP_001297368.1, NM_001310439.1 [Q9R1V6-6]
NP_001297369.1, NM_001310440.1 [Q9R1V6-3]
XP_006503592.1, XM_006503529.3 [Q9R1V6-12]
XP_006503593.1, XM_006503530.3 [Q9R1V6-11]
XP_006503594.1, XM_006503531.3 [Q9R1V6-14]
XP_006503596.1, XM_006503533.3 [Q9R1V6-8]
XP_006503598.1, XM_006503535.3 [Q9R1V6-15]
XP_006503600.1, XM_006503537.3 [Q9R1V6-7]
XP_006503605.1, XM_006503542.3 [Q9R1V6-5]
UniGeneiMm.275895

Genome annotation databases

EnsembliENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537 [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537 [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537 [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537 [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537 [Q9R1V6-6]
GeneIDi11496
KEGGimmu:11496
UCSCiuc008wjk.2 mouse [Q9R1V6-3]
uc008wjv.1 mouse [Q9R1V6-4]
uc008wjy.1 mouse [Q9R1V6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiADA22_MOUSE
AccessioniPrimary (citable) accession number: Q9R1V6
Secondary accession number(s): Q5TLI8
, Q5TLI9, Q5TLJ0, Q5TLJ1, Q5TLJ2, Q5TLJ3, Q5TLJ4, Q5TLJ5, Q5TLJ6, Q5TLJ7, Q5TLJ8, Q5TLJ9, Q5TLK0, Q5TLK1, Q5TLK2, Q5TLK3, Q5TLK4, Q5TLK5, Q5TLK6, Q5TLK7, Q5TLK8, Q8BSF2, Q9R1V5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 2, 2006
Last modified: July 18, 2018
This is version 153 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health