Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SUMO-activating enzyme subunit 1

Gene

Sae1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2 (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein sumoylation

This protein is involved in the pathway protein sumoylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein sumoylation and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLigase
Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-3065676 SUMO is conjugated to E1 (UBA2:SAE1)
R-MMU-3065678 SUMO is transferred from E1 to E2 (UBE2I, UBC9)

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00886

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SUMO-activating enzyme subunit 1
Alternative name(s):
Ubiquitin-like 1-activating enzyme E1A
Cleaved into the following chain:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sae1
Synonyms:Aos1, Sua1, Ubl1a1, Uble1a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1929264 Sae1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004232911 – 350SUMO-activating enzyme subunit 1Add BLAST350
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved; alternateBy similarity
ChainiPRO_00001949672 – 350SUMO-activating enzyme subunit 1, N-terminally processedAdd BLAST349

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei2N-acetylvaline; in SUMO-activating enzyme subunit 1, N-terminally processedBy similarity1
Modified residuei16PhosphoserineBy similarity1
Modified residuei202N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9R1T2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9R1T2

PeptideAtlas

More...
PeptideAtlasi
Q9R1T2

PRoteomics IDEntifications database

More...
PRIDEi
Q9R1T2

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
Q9R1T2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9R1T2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9R1T2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9R1T2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Broadly expressed, with highest levels in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000052833 Expressed in 301 organ(s), highest expression level in embryo

CleanEx database of gene expression profiles

More...
CleanExi
MM_SAE1

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9R1T2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of SAE1 and UBA2/SAE2. The heterodimer corresponds to the two domains that are encoded on a single polypeptide chain in ubiquitin-activating enzyme E1. Interacts with UBE2I (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
207998, 2 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-3041 SUMO activating enzyme complex
CPX-3046 activated SUMO1-E1 ligase complex
CPX-3047 activated SUMO2-E1 ligase complex
CPX-3048 activated SUMO3-E1 ligase complex

Protein interaction database and analysis system

More...
IntActi
Q9R1T2, 1 interactor

Molecular INTeraction database

More...
MINTi
Q9R1T2

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000092409

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9R1T2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9R1T2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ubiquitin-activating E1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2014 Eukaryota
COG0476 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00550000075007

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000172217

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080782

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9R1T2

KEGG Orthology (KO)

More...
KOi
K10684

Identification of Orthologs from Complete Genome Data

More...
OMAi
RDPSYKT

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0DZ1

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9R1T2

TreeFam database of animal gene trees

More...
TreeFami
TF315037

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000594 ThiF_NAD_FAD-bd
IPR035985 Ubiquitin-activating_enz
IPR000011 UBQ/SUMO-activ_enz_E1-like

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00899 ThiF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01849 UBIQUITINACT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF69572 SSF69572, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9R1T2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVEKEEAGGG GGGGISEEEA AQYDRQIRLW GLEAQKRLRA SRVLIVGMKG
60 70 80 90 100
LGAEIAKNLI LAGVKGLTML DHEQVSPEDP GAQFLIQTGS VGRNRAEASL
110 120 130 140 150
ERAQNLNPMV DVKVDTEDVE KKPESFFTKF DAVCLTCCSR DVIIKVDQIC
160 170 180 190 200
HRNSIKFFTG DVFGYHGYTF ANLGEHEFVE EKTKVAKVSQ GVEDGPEAKR
210 220 230 240 250
AKLDSSETTM VKKKVLFCPV KEALEVDWSG EKAKAALKRT APDYFLLQVL
260 270 280 290 300
LKFRTDKGRD PTSESYKEDA ELLLQIRNDV FDSLGISPDL LPDDFVRYCF
310 320 330 340 350
SEMAPVCAVV GGILAQEIVK ALSQRDPPHN NFFFFDGMKG SGIVECLGPQ
Length:350
Mass (Da):38,620
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i333108F6E98BABAA
GO
Isoform 2 (identifier: Q9R1T2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     321-350: ALSQRDPPHNNFFFFDGMKGSGIVECLGPQ → VCLGTMCV

Note: No experimental confirmation available.
Show »
Length:328
Mass (Da):36,135
Checksum:iD979A4D5950C2E4F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_022004321 – 350ALSQR…CLGPQ → VCLGTMCV in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB024303 mRNA Translation: BAA82876.1
AK010313 mRNA Translation: BAB26845.1
AK011783 mRNA Translation: BAB27838.1
AK087556 mRNA Translation: BAC39925.1
AK090012 mRNA Translation: BAC41044.1
AK154139 mRNA Translation: BAE32401.1
AK159672 mRNA Translation: BAE35276.1
AK162789 mRNA Translation: BAE37060.1
BC068164 mRNA Translation: AAH68164.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20848.1 [Q9R1T2-1]
CCDS85221.1 [Q9R1T2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001272820.1, NM_001285891.1 [Q9R1T2-1]
NP_001272821.1, NM_001285892.1 [Q9R1T2-2]
NP_062722.1, NM_019748.3 [Q9R1T2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.258530

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000094815; ENSMUSP00000092409; ENSMUSG00000052833 [Q9R1T2-1]
ENSMUST00000210999; ENSMUSP00000147409; ENSMUSG00000052833 [Q9R1T2-1]
ENSMUST00000211741; ENSMUSP00000147771; ENSMUSG00000052833 [Q9R1T2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56459

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:56459

UCSC genome browser

More...
UCSCi
uc009fhp.2 mouse [Q9R1T2-1]
uc009fhq.2 mouse [Q9R1T2-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024303 mRNA Translation: BAA82876.1
AK010313 mRNA Translation: BAB26845.1
AK011783 mRNA Translation: BAB27838.1
AK087556 mRNA Translation: BAC39925.1
AK090012 mRNA Translation: BAC41044.1
AK154139 mRNA Translation: BAE32401.1
AK159672 mRNA Translation: BAE35276.1
AK162789 mRNA Translation: BAE37060.1
BC068164 mRNA Translation: AAH68164.1
CCDSiCCDS20848.1 [Q9R1T2-1]
CCDS85221.1 [Q9R1T2-2]
RefSeqiNP_001272820.1, NM_001285891.1 [Q9R1T2-1]
NP_001272821.1, NM_001285892.1 [Q9R1T2-2]
NP_062722.1, NM_019748.3 [Q9R1T2-1]
UniGeneiMm.258530

3D structure databases

ProteinModelPortaliQ9R1T2
SMRiQ9R1T2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207998, 2 interactors
ComplexPortaliCPX-3041 SUMO activating enzyme complex
CPX-3046 activated SUMO1-E1 ligase complex
CPX-3047 activated SUMO2-E1 ligase complex
CPX-3048 activated SUMO3-E1 ligase complex
IntActiQ9R1T2, 1 interactor
MINTiQ9R1T2
STRINGi10090.ENSMUSP00000092409

PTM databases

iPTMnetiQ9R1T2
PhosphoSitePlusiQ9R1T2
SwissPalmiQ9R1T2

2D gel databases

REPRODUCTION-2DPAGEiQ9R1T2

Proteomic databases

EPDiQ9R1T2
PaxDbiQ9R1T2
PeptideAtlasiQ9R1T2
PRIDEiQ9R1T2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000094815; ENSMUSP00000092409; ENSMUSG00000052833 [Q9R1T2-1]
ENSMUST00000210999; ENSMUSP00000147409; ENSMUSG00000052833 [Q9R1T2-1]
ENSMUST00000211741; ENSMUSP00000147771; ENSMUSG00000052833 [Q9R1T2-2]
GeneIDi56459
KEGGimmu:56459
UCSCiuc009fhp.2 mouse [Q9R1T2-1]
uc009fhq.2 mouse [Q9R1T2-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10055
MGIiMGI:1929264 Sae1

Phylogenomic databases

eggNOGiKOG2014 Eukaryota
COG0476 LUCA
GeneTreeiENSGT00550000075007
HOGENOMiHOG000172217
HOVERGENiHBG080782
InParanoidiQ9R1T2
KOiK10684
OMAiRDPSYKT
OrthoDBiEOG091G0DZ1
PhylomeDBiQ9R1T2
TreeFamiTF315037

Enzyme and pathway databases

UniPathwayi
UPA00886

ReactomeiR-MMU-3065676 SUMO is conjugated to E1 (UBA2:SAE1)
R-MMU-3065678 SUMO is transferred from E1 to E2 (UBE2I, UBC9)

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sae1 mouse

Protein Ontology

More...
PROi
PR:Q9R1T2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000052833 Expressed in 301 organ(s), highest expression level in embryo
CleanExiMM_SAE1
GenevisibleiQ9R1T2 MM

Family and domain databases

InterProiView protein in InterPro
IPR000594 ThiF_NAD_FAD-bd
IPR035985 Ubiquitin-activating_enz
IPR000011 UBQ/SUMO-activ_enz_E1-like
PfamiView protein in Pfam
PF00899 ThiF, 1 hit
PRINTSiPR01849 UBIQUITINACT
SUPFAMiSSF69572 SSF69572, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSAE1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9R1T2
Secondary accession number(s): Q3TRG9, Q3TWJ0, Q9CSW9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again