Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 105 (08 May 2019)
Sequence version 2 (25 Jul 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

GPI ethanolamine phosphate transferase 1

Gene

Pign

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the first alpha-1,4-linked mannose of the glycosylphosphatidylinositol precursor of GPI-anchor. May act as suppressor of replication stress and chromosome missegregation.1 Publication

Miscellaneous

Target of the inhibitor of GPI biosynthesis YW3548/BE49385A.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: glycosylphosphatidylinositol-anchor biosynthesis

This protein is involved in the pathway glycosylphosphatidylinositol-anchor biosynthesis, which is part of Glycolipid biosynthesis.
View all proteins of this organism that are known to be involved in the pathway glycosylphosphatidylinositol-anchor biosynthesis and in Glycolipid biosynthesis.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processGPI-anchor biosynthesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-162710 Synthesis of glycosylphosphatidylinositol (GPI)

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00196

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GPI ethanolamine phosphate transferase 1 (EC:2.-.-.-)
Alternative name(s):
Phosphatidylinositol-glycan biosynthesis class N protein
Short name:
PIG-N
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pign
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1351629 Pign

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1CytoplasmicSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei2 – 22HelicalSequence analysisAdd BLAST21
Topological domaini23 – 442LumenalSequence analysisAdd BLAST420
Transmembranei443 – 463HelicalSequence analysisAdd BLAST21
Topological domaini464 – 480CytoplasmicSequence analysisAdd BLAST17
Transmembranei481 – 501HelicalSequence analysisAdd BLAST21
Topological domaini502LumenalSequence analysis1
Transmembranei503 – 523HelicalSequence analysisAdd BLAST21
Topological domaini524 – 543CytoplasmicSequence analysisAdd BLAST20
Transmembranei544 – 564HelicalSequence analysisAdd BLAST21
Topological domaini565LumenalSequence analysis1
Transmembranei566 – 586HelicalSequence analysisAdd BLAST21
Topological domaini587 – 591CytoplasmicSequence analysis5
Transmembranei592 – 612HelicalSequence analysisAdd BLAST21
Topological domaini613 – 618LumenalSequence analysis6
Transmembranei619 – 639HelicalSequence analysisAdd BLAST21
Topological domaini640 – 649CytoplasmicSequence analysis10
Transmembranei650 – 670HelicalSequence analysisAdd BLAST21
Topological domaini671 – 685LumenalSequence analysisAdd BLAST15
Transmembranei686 – 706HelicalSequence analysisAdd BLAST21
Topological domaini707 – 723CytoplasmicSequence analysisAdd BLAST17
Transmembranei724 – 744HelicalSequence analysisAdd BLAST21
Topological domaini745 – 786LumenalSequence analysisAdd BLAST42
Transmembranei787 – 807HelicalSequence analysisAdd BLAST21
Topological domaini808 – 824CytoplasmicSequence analysisAdd BLAST17
Transmembranei825 – 845HelicalSequence analysisAdd BLAST21
Topological domaini846 – 858LumenalSequence analysisAdd BLAST13
Transmembranei859 – 879HelicalSequence analysisAdd BLAST21
Topological domaini880 – 894CytoplasmicSequence analysisAdd BLAST15
Transmembranei895 – 915HelicalSequence analysisAdd BLAST21
Topological domaini916 – 931LumenalSequence analysisAdd BLAST16

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002461991 – 931GPI ethanolamine phosphate transferase 1Add BLAST931

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi128N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi192N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi295N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi350N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi616N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9R1S3

PRoteomics IDEntifications database

More...
PRIDEi
Q9R1S3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9R1S3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9R1S3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9R1S3

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000139638

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PIGG/PIGN/PIGO family. PIGN subfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2124 Eukaryota
COG1524 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000170818

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9R1S3

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9R1S3

Family and domain databases

Conserved Domains Database

More...
CDDi
cd16020 GPI_EPT_1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.720.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017850 Alkaline_phosphatase_core_sf
IPR007070 GPI_EtnP_transferase_1
IPR017852 GPI_EtnP_transferase_1_C
IPR002591 Phosphodiest/P_Trfase
IPR037671 PIGN_N

The PANTHER Classification System

More...
PANTHERi
PTHR12250 PTHR12250, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01663 Phosphodiest, 1 hit
PF04987 PigN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53649 SSF53649, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9R1S3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLLFFALGLL IHFVFFASIF DIYFTSPLVH GMTPQFTPLP PPAKRLVLFV
60 70 80 90 100
ADGLRADTLY ELDEDGNSRA PFIRNVIIHE GSWGVSHTRV PTESRPGHVA
110 120 130 140 150
LIAGFYEDVS AVAKGWKENP VEFDSLFNES KYTWSWGSPD ILPMFAKGAS
160 170 180 190 200
GDHVYTYSYD AQREDFGAHD ATKLDTWVFD KVKDFFDAAR NNQSLFTKVN
210 220 230 240 250
EEKVVFFLHL LGIDTNGHAH RPSSREYKDN IKKVDDGVKE IVSIFKHFYG
260 270 280 290 300
DDGKTAFIFT SDHGMTDWGS HGAGHPSETL TPFVTWGAGI KFPQNVSAQQ
310 320 330 340 350
YDDEFLKEWR LENWKRRDVN QADIAPLMAS LIGVPFPLNS VGILPVGYLN
360 370 380 390 400
NTGLFKAESM FTNAVQILEQ FKVKMTQKKE ATLPFLFTPF KLLSDSQQLD
410 420 430 440 450
ILRKARSYIK QEKFDEVVSL CEELIDLALR GLSYYHTYDR LFLGINVAVG
460 470 480 490 500
FVGWMSYTSL LIIKSHSNIP KGTRKEGKKP HCLLLYSFIA TGVLVACFLM
510 520 530 540 550
IQACPWTYYV YCLLPVPIWY AVLREHEVIQ DLVESLLTFP RSHFVAYLLV
560 570 580 590 600
FTLGIEVLVL SFFYRYMLTA GLIVFAGWPF LTQLWTRAKI TFLSWAFFSL
610 620 630 640 650
LLAVFPLMPV VGRKPNLSLV MGAGFLVLLL SLAVVTTLGK RNIKLVKGEL
660 670 680 690 700
LVLLLQMLST VLSMYVVYST HHSLLKKEGL PLMNQIVSWA TLASSLVAPL
710 720 730 740 750
LSSTALSQRL ASILLSLMST YLLLSTGYEA LFPLVLSCLM FVWIQVEQET
760 770 780 790 800
LQQPGVSCKQ KLTSIQFTCD TDIAQFRQLC PDDIRRAFFL VFFLLTAFFG
810 820 830 840 850
TGNIASINSF DLASVYCFLT VFSPFMMGAL MMWKILIPFV LVMCAFEAVQ
860 870 880 890 900
ITTQLSSKGL FLVVLIISDI MALHFFFLVK DSGSWLDIGT SISHYVIVMS
910 920 930
MTIFLVFLNG LAQLLTTKKL QLCGKPKSHL M
Length:931
Mass (Da):105,045
Last modified:July 25, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i75637C514E8D3AF4
GO
Isoform 2 (identifier: Q9R1S3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     791-798: VFFLLTAF → FFCPRRNY
     799-931: Missing.

Show »
Length:798
Mass (Da):90,437
Checksum:iE6860A2D1C81C30E
GO
Isoform 3 (identifier: Q9R1S3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     791-826: VFFLLTAFFGTGNIASINSFDLASVYCFLTVFSPFM → ILLIFPVFLRLFDYKRIRILLAQENYHRSLKAAWEL
     827-931: Missing.

Note: No experimental confirmation available.
Show »
Length:826
Mass (Da):93,795
Checksum:i9ECECCED4C136EB7
GO
Isoform 4 (identifier: Q9R1S3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-602: Missing.
     603-692: AVFPLMPVVG...MNQIVSWATL → MVLFISITCL...GEVGVLGSDD

Note: No experimental confirmation available.
Show »
Length:329
Mass (Da):36,413
Checksum:i848A62BB56C3D75C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3X9F1G3X9F1_MOUSE
GPI ethanolamine phosphate transfer...
Pign mCG_16111
931Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQ32A0A087WQ32_MOUSE
GPI ethanolamine phosphate transfer...
Pign
826Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WS03A0A087WS03_MOUSE
GPI ethanolamine phosphate transfer...
Pign
798Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WNT9A0A087WNT9_MOUSE
GPI ethanolamine phosphate transfer...
Pign
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti17A → V in BAA82619 (PubMed:10574991).Curated1
Sequence conflicti17A → V in BAA82620 (PubMed:10574991).Curated1
Sequence conflicti78I → M in BAA82619 (PubMed:10574991).Curated1
Sequence conflicti78I → M in BAA82620 (PubMed:10574991).Curated1
Sequence conflicti78I → M in BAA82663 (PubMed:10574991).Curated1
Sequence conflicti213I → V in BAA82619 (PubMed:10574991).Curated1
Sequence conflicti213I → V in BAA82620 (PubMed:10574991).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0198341 – 602Missing in isoform 4. 1 PublicationAdd BLAST602
Alternative sequenceiVSP_019835603 – 692AVFPL…SWATL → MVLFISITCLYVFSSFSVRT STCLIVFSCFSLRTCNSLAV FSCISLSDLLKSFLMSSIII MRYAFKSRSRFSGVLGCPGL GEVGVLGSDD in isoform 4. 1 PublicationAdd BLAST90
Alternative sequenceiVSP_019836791 – 826VFFLL…FSPFM → ILLIFPVFLRLFDYKRIRIL LAQENYHRSLKAAWEL in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_019837791 – 798VFFLLTAF → FFCPRRNY in isoform 2. 1 Publication8
Alternative sequenceiVSP_019838799 – 931Missing in isoform 2. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_019839827 – 931Missing in isoform 3. 1 PublicationAdd BLAST105

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB030279 mRNA Translation: BAA82619.1
AB030280 mRNA Translation: BAA82620.1
AB030316 Genomic DNA Translation: BAA82663.1
AK132928 mRNA Translation: BAE21427.1
BC021148 mRNA Translation: AAH21148.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS15205.1 [Q9R1S3-1]

Genome annotation databases

UCSC genome browser

More...
UCSCi
uc011wqa.2 mouse [Q9R1S3-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030279 mRNA Translation: BAA82619.1
AB030280 mRNA Translation: BAA82620.1
AB030316 Genomic DNA Translation: BAA82663.1
AK132928 mRNA Translation: BAE21427.1
BC021148 mRNA Translation: AAH21148.1
CCDSiCCDS15205.1 [Q9R1S3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000139638

PTM databases

iPTMnetiQ9R1S3
PhosphoSitePlusiQ9R1S3
SwissPalmiQ9R1S3

Proteomic databases

PaxDbiQ9R1S3
PRIDEiQ9R1S3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiuc011wqa.2 mouse [Q9R1S3-4]

Organism-specific databases

MGIiMGI:1351629 Pign

Phylogenomic databases

eggNOGiKOG2124 Eukaryota
COG1524 LUCA
HOGENOMiHOG000170818
InParanoidiQ9R1S3
PhylomeDBiQ9R1S3

Enzyme and pathway databases

UniPathwayiUPA00196
ReactomeiR-MMU-162710 Synthesis of glycosylphosphatidylinositol (GPI)

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9R1S3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

CDDicd16020 GPI_EPT_1, 1 hit
Gene3Di3.40.720.10, 1 hit
InterProiView protein in InterPro
IPR017850 Alkaline_phosphatase_core_sf
IPR007070 GPI_EtnP_transferase_1
IPR017852 GPI_EtnP_transferase_1_C
IPR002591 Phosphodiest/P_Trfase
IPR037671 PIGN_N
PANTHERiPTHR12250 PTHR12250, 1 hit
PfamiView protein in Pfam
PF01663 Phosphodiest, 1 hit
PF04987 PigN, 1 hit
SUPFAMiSSF53649 SSF53649, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPIGN_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9R1S3
Secondary accession number(s): Q3V0S6
, Q8VCC3, Q9R1S1, Q9R1S2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: July 25, 2006
Last modified: May 8, 2019
This is version 105 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again