Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (13 Nov 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sodium bicarbonate cotransporter 3

Gene

Slc4a7

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. May be inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA) (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-425381 Bicarbonate transporters

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.31.2.1 the anion exchanger (ae) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium bicarbonate cotransporter 3
Alternative name(s):
Electroneutral sodium bicarbonate cotransporter 1
NBC-like protein
Solute carrier family 4 member 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc4a7
Synonyms:Nbc, Nbc2, Nbc3, Nbcn1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Rat genome database

More...
RGDi
621208 Slc4a7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 612ExtracellularSequence analysisAdd BLAST612
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei613 – 633HelicalSequence analysisAdd BLAST21
Topological domaini634 – 641CytoplasmicSequence analysis8
Transmembranei642 – 662HelicalSequence analysisAdd BLAST21
Topological domaini663 – 699ExtracellularSequence analysisAdd BLAST37
Transmembranei700 – 720HelicalSequence analysisAdd BLAST21
Topological domaini721 – 729CytoplasmicSequence analysis9
Transmembranei730 – 750HelicalSequence analysisAdd BLAST21
Topological domaini751 – 821ExtracellularSequence analysisAdd BLAST71
Transmembranei822 – 842HelicalSequence analysisAdd BLAST21
Topological domaini843 – 865CytoplasmicSequence analysisAdd BLAST23
Transmembranei866 – 886HelicalSequence analysisAdd BLAST21
Topological domaini887 – 912ExtracellularSequence analysisAdd BLAST26
Transmembranei913 – 933HelicalSequence analysisAdd BLAST21
Topological domaini934 – 958CytoplasmicSequence analysisAdd BLAST25
Transmembranei959 – 979HelicalSequence analysisAdd BLAST21
Topological domaini980 – 1015ExtracellularSequence analysisAdd BLAST36
Transmembranei1016 – 1036HelicalSequence analysisAdd BLAST21
Topological domaini1037 – 1038CytoplasmicSequence analysis2
Transmembranei1039 – 1059HelicalSequence analysisAdd BLAST21
Topological domaini1060 – 1096ExtracellularSequence analysisAdd BLAST37
Transmembranei1097 – 1117HelicalSequence analysisAdd BLAST21
Topological domaini1118 – 1218CytoplasmicSequence analysisAdd BLAST101

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000792351 – 1218Sodium bicarbonate cotransporter 3Add BLAST1218

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei57PhosphoserineBy similarity1
Modified residuei60PhosphoserineBy similarity1
Modified residuei89PhosphoserineCombined sources1
Modified residuei155PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi176N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei238PhosphoserineBy similarity1
Modified residuei247PhosphoserineCombined sources1
Glycosylationi274N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei386PhosphoserineBy similarity1
Modified residuei404PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Glycosylationi410N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei411PhosphoserineBy similarity1
Modified residuei560PhosphoserineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi770 ↔ 772By similarity
Glycosylationi780N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi790N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi800N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi806 ↔ 818By similarity
Modified residuei1171PhosphothreonineBy similarity1
Modified residuei1180PhosphoserineBy similarity1
Modified residuei1217PhosphoserineBy similarity1
Isoform 4 (identifier: Q9R1N3-4)
Modified residuei263PhosphoserineCombined sources1
Modified residuei1078PhosphoserineCombined sources1
Isoform 6 (identifier: Q9R1N3-6)
Modified residuei263PhosphoserineCombined sources1
Isoform 5 (identifier: Q9R1N3-5)
Modified residuei1067PhosphoserineCombined sources1
Isoform 3 (identifier: Q9R1N3-3)
Modified residuei1188PhosphoserineCombined sources1
Isoform 2 (identifier: Q9R1N3-2)
Modified residuei1201PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9R1N3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9R1N3

PRoteomics IDEntifications database

More...
PRIDEi
Q9R1N3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9R1N3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9R1N3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9R1N3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in aorta, ventricles, atrium, mesenteric artery, kidney, spleen, duodenum, jejunum, ileum, colon, lung, trachea, gastric fundus and pylorus, cerebrum, cerebellum, pancreas, liver, parotid gland, and epididymis. Expressed in the inner ear by cochlear outer and inner hair cells (at protein level). Highly expressed in testis and spleen. Also detected in heart, brain, lung, liver and kidney. Isoform 4 and isoform 5 are specifically expressed in kidney. Isoform 6 is specifically expressed in hippocampal neurons.5 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in kidney upon metabolic acidosis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000005957 Expressed in 9 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9R1N3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9R1N3 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with USH1C.

Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50.

Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2 (By similarity).

Interacts with CFTR probably through SLC9A3R1/EBP50.

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
250777, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000008759

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1138 – 1140CA2-bindingBy similarity3

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1215 – 1218PDZ-bindingBy similarity4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1172 Eukaryota
ENOG410XPHD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157045

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000280684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9R1N3

KEGG Orthology (KO)

More...
KOi
K13858

Identification of Orthologs from Complete Genome Data

More...
OMAi
WSPIIAV

Database of Orthologous Groups

More...
OrthoDBi
265068at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9R1N3

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.930.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013769 Band3_cytoplasmic_dom
IPR011531 HCO3_transpt_C
IPR003020 HCO3_transpt_euk
IPR016152 PTrfase/Anion_transptr

The PANTHER Classification System

More...
PANTHERi
PTHR11453 PTHR11453, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07565 Band_3_cyto, 1 hit
PF00955 HCO3_cotransp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01231 HCO3TRNSPORT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55804 SSF55804, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00834 ae, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9R1N3-1) [UniParc]FASTAAdd to basket
Also known as: NBCn1-B, NBCn1B

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEADGAGEQM RPLLTRGPDE EAVVDLGKTS STVNTKFEKE ELESHRAVYV
60 70 80 90 100
GVHVPFSKES RRRHRHRGHK HHHRRRKDKD SDKEDGRESP SYDTPSQRVQ
110 120 130 140 150
FILGTEDDDE EHIPHDLFTE MDELCYRDGE EYEWKETARW LKFEEDVEDG
160 170 180 190 200
GDRWSKPYVA TLSLHSLFEL RSCILNGTVM LDMRASTLDE IADMVLDNMI
210 220 230 240 250
ASGQLDDSIR ENVREALLKR HHHQNEKRFT SRIPLVRSFA DIGKKHSDPH
260 270 280 290 300
LLERNGEGLS ASRHSLRTGL SASNLSLRGE SPLSLLLSHL LPSSRAGTPA
310 320 330 340 350
GSRCTTPVPT PQNSPPSSPS LSRLTSRSSQ QTQPQAPEVL VSPDRDDIPR
360 370 380 390 400
VVIHPPEEDI EALKGQEQKN EENTDFTPGI LASPQSAPGN LDSSKSGEVK
410 420 430 440 450
GNGSGGSREN STVDFSKVDM NFMRKIPTGA EASNVLVGEV DFLERPIIAF
460 470 480 490 500
VRLAPAVLLS GLTEVPVPTR FLFLLLGPAG KAPQYHEIGR SIATLMTDEI
510 520 530 540 550
FHDVAYKAKD RNDLLSGIDE FLDQVTVLPP GEWDPSIRIE PPKSVPSQEK
560 570 580 590 600
RKIPAFPNGS APVSADPPKE ADHHAGPELQ RTGRLFGGLI LDIKRKAPFF
610 620 630 640 650
LSDFKDALSL QCLASILFLY CACMSPVITF GGLLGEATEG RISAIESLFG
660 670 680 690 700
ASLTGIAYSL FAGQPLTILG STGPVLVFEK ILFKFCRDYH LSYLSLRTSI
710 720 730 740 750
GLWTSFLCIV LVATDASSLV CYITRFTEEA FAALICIIFI YEALEKLFHL
760 770 780 790 800
GEIYAFNMHN NLDALTSYTC VCAEPSNPSN ETVELWERKN VTAASISWAN
810 820 830 840 850
LTVSECKTFH GMFVGSACGP HGPYVPDVLF WCVVLFFTTF FLSSFLKQFK
860 870 880 890 900
TKRYFPTKVR STISDFAVFL TIVIMVAIDY LVGIPSPKLH VPEKFEPTDP
910 920 930 940 950
SRGWIISPLG DNPWWTLLIA AVPALLCTIL IFMDQQITAV IINRKEHKLK
960 970 980 990 1000
KGAGYHLDLL MVAVMLGVCS IMGLPWFVAA TVLSISHVNS LKVESECSAP
1010 1020 1030 1040 1050
GEQPKFLGIR EQRVTGLMIF ILMGLSVFMT SVLKFIPMPV LYGVFLYMGV
1060 1070 1080 1090 1100
SSLKGIQFFD RIKLFGMPAK HQPDLIYLRY VPLWKVHVFT VVQLTCLVLL
1110 1120 1130 1140 1150
WVIKASAAAV VFPMMVLALV FVRKLMDLCF TKRELSWLDD LMPESKKKKE
1160 1170 1180 1190 1200
DDKKKKEKEE AERMLQGDGD TVHLPFERGS LLQIPVKTLK YSPEKPVSVT
1210
INFEDEPSKK YMDAETSL
Length:1,218
Mass (Da):135,954
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF5C8BD4F49CAB00
GO
Isoform 2 (identifier: Q9R1N3-2) [UniParc]FASTAAdd to basket
Also known as: NBCn1-D, NBCn1D

The sequence of this isoform differs from the canonical sequence as follows:
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,254
Mass (Da):139,914
Checksum:iF1A3407D82806571
GO
Isoform 3 (identifier: Q9R1N3-3) [UniParc]FASTAAdd to basket
Also known as: NBCn1-C, NBCn1C

The sequence of this isoform differs from the canonical sequence as follows:
     245-257: Missing.
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,241
Mass (Da):138,401
Checksum:i47EB5697EDF23794
GO
Isoform 4 (identifier: Q9R1N3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     256-378: Missing.
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,131
Mass (Da):126,849
Checksum:i017EE50156ADFA01
GO
Isoform 5 (identifier: Q9R1N3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-255: Missing.
     256-378: Missing.
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,120
Mass (Da):125,521
Checksum:i1E56095A4D774548
GO
Isoform 6 (identifier: Q9R1N3-6) [UniParc]FASTAAdd to basket
Also known as: NBCn1-E

The sequence of this isoform differs from the canonical sequence as follows:
     256-378: Missing.

Show »
Length:1,095
Mass (Da):122,888
Checksum:i8D6D1CFE08856115
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_017169245 – 257Missing in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_017170245 – 255Missing in isoform 5. CuratedAdd BLAST11
Alternative sequenceiVSP_017171256 – 378Missing in isoform 4, isoform 5 and isoform 6. CuratedAdd BLAST123
Alternative sequenceiVSP_0171721192S → SIDPSVVNISDEMAKTAQWK ALSMNTENAKVTRPNMS in isoform 2, isoform 3, isoform 4 and isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF069511 mRNA Translation: AAF14345.1
AF070475 mRNA Translation: AAD46389.1
AF080106 mRNA Translation: AAD47142.1

NCBI Reference Sequences

More...
RefSeqi
NP_001257790.1, NM_001270861.1 [Q9R1N3-1]
NP_478118.1, NM_058211.2 [Q9R1N3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000008759; ENSRNOP00000008759; ENSRNOG00000005957 [Q9R1N3-2]
ENSRNOT00000049771; ENSRNOP00000047758; ENSRNOG00000005957 [Q9R1N3-1]
ENSRNOT00000068171; ENSRNOP00000063542; ENSRNOG00000005957 [Q9R1N3-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
117955

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:117955

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069511 mRNA Translation: AAF14345.1
AF070475 mRNA Translation: AAD46389.1
AF080106 mRNA Translation: AAD47142.1
RefSeqiNP_001257790.1, NM_001270861.1 [Q9R1N3-1]
NP_478118.1, NM_058211.2 [Q9R1N3-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi250777, 1 interactor
STRINGi10116.ENSRNOP00000008759

Protein family/group databases

TCDBi2.A.31.2.1 the anion exchanger (ae) family

PTM databases

iPTMnetiQ9R1N3
PhosphoSitePlusiQ9R1N3
SwissPalmiQ9R1N3

Proteomic databases

jPOSTiQ9R1N3
PaxDbiQ9R1N3
PRIDEiQ9R1N3

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
117955

Genome annotation databases

EnsembliENSRNOT00000008759; ENSRNOP00000008759; ENSRNOG00000005957 [Q9R1N3-2]
ENSRNOT00000049771; ENSRNOP00000047758; ENSRNOG00000005957 [Q9R1N3-1]
ENSRNOT00000068171; ENSRNOP00000063542; ENSRNOG00000005957 [Q9R1N3-4]
GeneIDi117955
KEGGirno:117955

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9497
RGDi621208 Slc4a7

Phylogenomic databases

eggNOGiKOG1172 Eukaryota
ENOG410XPHD LUCA
GeneTreeiENSGT00940000157045
HOGENOMiHOG000280684
InParanoidiQ9R1N3
KOiK13858
OMAiWSPIIAV
OrthoDBi265068at2759
PhylomeDBiQ9R1N3

Enzyme and pathway databases

ReactomeiR-RNO-425381 Bicarbonate transporters

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9R1N3

Gene expression databases

BgeeiENSRNOG00000005957 Expressed in 9 organ(s), highest expression level in testis
ExpressionAtlasiQ9R1N3 baseline and differential
GenevisibleiQ9R1N3 RN

Family and domain databases

Gene3Di3.40.930.10, 2 hits
InterProiView protein in InterPro
IPR013769 Band3_cytoplasmic_dom
IPR011531 HCO3_transpt_C
IPR003020 HCO3_transpt_euk
IPR016152 PTrfase/Anion_transptr
PANTHERiPTHR11453 PTHR11453, 1 hit
PfamiView protein in Pfam
PF07565 Band_3_cyto, 1 hit
PF00955 HCO3_cotransp, 1 hit
PRINTSiPR01231 HCO3TRNSPORT
SUPFAMiSSF55804 SSF55804, 2 hits
TIGRFAMsiTIGR00834 ae, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS4A7_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9R1N3
Secondary accession number(s): Q9QYD5, Q9R1L1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 1, 2000
Last modified: November 13, 2019
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again